close

SimulationCraft 820-01

for World of Warcraft 8.2.0 Live (wow build level 30918)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-05-15 Real Procs Per Minute data removed from Killing Machine.
Killing Machine rppm 4.50 0.00
2019-03-12 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2018-05-02 Incorrect spell level for Icicle buff.
Icicles spell_level 78.00 80.00
2017-11-08 Incorrect spell level for Ignite.
Ignite spell_level 78.00 99.00
2017-11-06 Incorrect spell level for Icicle.
Icicle spell_level 78.00 80.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-01-07 Incorrect Maelstrom generation value for Chain Lightning Overloads.
Fulmination (effect#6) base_value 2.00 3.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

azsharas : 54461 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
54460.7 54460.7 104.2 / 0.191% 6889.3 / 12.7% 6132.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.4 8.3 Astral Power 0.00% 59.7 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator
Professions
  • engineering: 100
  • jewelcrafting: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
azsharas 54461
Azerite Spike 1035 1.9% 17.7 16.18sec 17508 0 Direct 17.6 13809 28410 17531 25.5%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.67 17.65 0.00 0.00 0.0000 0.0000 309290.05 309290.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.15 74.53% 13808.68 12665 15347 13802.99 13247 14624 181617 181617 0.00
crit 4.49 25.47% 28410.11 26090 31616 28112.28 0 31616 127673 127673 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295835
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:90.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295835
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:{$@spelldesc295834=Your spells and abilities have a high chance to impale your target with a spike of Azerite, causing ${$m1*(1+$@versadmg)} Fire damage.$?a295837[ When an Azerite spike deals damage, all damage you deal against that target is increased by {$295838s1=5}% for {$295838d=6 seconds}.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11696.33
  • base_dd_max:11696.33
  • base_dd_mult:1.00
 
Conch Strike 374 0.7% 13.0 22.20sec 8561 0 Direct 12.9 6841 14085 8639 24.8%  

Stats details: conch_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.04 12.93 0.00 0.00 0.0000 0.0000 111670.83 159529.75 30.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.72 75.17% 6841.38 6415 7067 6842.23 6638 7067 66473 94961 30.00
crit 3.21 24.83% 14084.82 13215 14558 13654.54 0 14558 45198 64568 29.09
 
 

Action details: conch_strike

Static Values
  • id:304698
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:304698
  • name:Conch Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc304697=While in Nazjatar or the Eternal Palace, your spells and abilities have a chance to deal Physical damage and increased threat to enemies in a small area around the target. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8462.82
  • base_dd_max:8462.82
  • base_dd_mult:1.00
 
Frost Blast 586 1.1% 13.2 21.69sec 13316 0 Direct 13.2 10507 21604 13315 25.3%  

Stats details: frost_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.15 13.15 0.00 0.00 0.0000 0.0000 175159.46 175159.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.82 74.69% 10506.58 9623 11661 10506.16 9980 11287 103219 103219 0.00
crit 3.33 25.31% 21603.96 19824 24023 20882.66 0 24023 71940 71940 0.00
 
 

Action details: frost_blast

Static Values
  • id:304645
  • school:frost
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:304645
  • name:Frost Blast
  • school:frost
  • tooltip:Slowed.
  • description:{$@spelldesc304640=While in Nazjatar or the Eternal Palace, your spells and abilities have a chance to deal {$304645s1=0} Frost damage to your target, slowing them for {$304645d=6 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8887.35
  • base_dd_max:8887.35
  • base_dd_mult:1.00
 
Gutripper 535 1.0% 38.1 7.68sec 4182 0 Direct 38.1 3308 6814 4182 25.0%  

Stats details: gutripper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.09 38.09 0.00 0.00 0.0000 0.0000 159300.79 227572.55 30.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.59 75.05% 3307.59 3100 3415 3308.84 3231 3393 94548 135069 30.00
crit 9.50 24.95% 6813.95 6386 7035 6816.10 6614 7035 64753 92504 30.00
 
 

Action details: gutripper

Static Values
  • id:269031
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:269031
  • name:Gutripper
  • school:physical
  • tooltip:
  • description:{$@spelldesc266937=Your damaging abilities have a chance to deal {$s1=1112} Physical damage to the target. Gutripper occurs much more often against targets below {$s2=30}% health. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4090.00
  • base_dd_max:4090.00
  • base_dd_mult:1.00
 
Heed My Call 354 (505) 0.7% (0.9%) 8.7 32.04sec 17373 0 Direct 8.7 9587 19742 12180 25.5%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.69 8.69 0.00 0.00 0.0000 0.0000 105886.60 105886.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.48 74.48% 9586.75 8778 10637 9586.03 9048 10637 62081 62081 0.00
crit 2.22 25.52% 19742.24 18082 21912 17648.16 0 21912 43805 43805 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 151 0.3% 8.7 32.04sec 5195 0 Direct 8.7 4105 8481 5194 24.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.69 8.69 0.00 0.00 0.0000 0.0000 45168.86 45168.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.53 75.10% 4105.33 3762 4559 4102.12 0 4559 26805 26805 0.00
crit 2.17 24.90% 8481.29 7749 9391 7468.25 0 9391 18363 18363 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6530 12.0% 80.0 3.65sec 24386 19983 Direct 80.0 19191 39484 24389 25.6%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.97 79.97 0.00 0.00 1.2204 0.0000 1950135.12 1950135.12 0.00 19982.74 19982.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.49 74.40% 19191.12 10416 28084 19201.46 18263 20210 1141746 1141746 0.00
crit 20.47 25.60% 39484.00 21739 57853 39513.79 35874 45516 808389 808389 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3211 5.9% 14.1 21.41sec 68148 71289 Direct 14.1 3247 6672 4098 24.8%  
Periodic 237.4 2993 6168 3795 25.2% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.06 14.06 237.37 237.37 0.9560 1.2503 958193.37 958193.37 0.00 3088.73 71288.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.58 75.24% 3246.92 2546 4646 3249.52 2886 3733 34351 34351 0.00
crit 3.48 24.76% 6672.44 5318 9570 6541.15 0 9115 23226 23226 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 177.5 74.77% 2993.35 12 4325 2995.03 2863 3139 531216 531216 0.00
crit 59.9 25.23% 6167.50 15 8910 6170.97 5834 6603 369401 369401 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Potion of Unbridled Fury 1446 2.6% 78.7 3.13sec 5426 0 Direct 78.7 4275 8805 5426 25.4%  

Stats details: potion_of_unbridled_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.67 78.67 0.00 0.00 0.0000 0.0000 426900.28 426900.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.68 74.58% 4274.99 3898 4724 4274.89 4102 4491 250827 250827 0.00
crit 20.00 25.42% 8804.73 8030 9731 8805.35 8357 9334 176073 176073 0.00
 
 

Action details: potion_of_unbridled_fury

Static Values
  • id:300717
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:300717
  • name:Potion of Unbridled Fury
  • school:fire
  • tooltip:
  • description:Deal {$s1=3600} Fire damage to your current target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3600.00
  • base_dd_max:3600.00
  • base_dd_mult:1.00
 
Shooting Stars 1172 2.2% 47.4 6.25sec 7369 0 Direct 47.4 5818 11980 7368 25.2%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.45 47.45 0.00 0.00 0.0000 0.0000 349630.40 349630.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.51 74.84% 5818.20 4579 8409 5821.85 5305 6442 206619 206619 0.00
crit 11.94 25.16% 11979.88 9491 17322 11985.66 10257 14117 143011 143011 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3985 (5798) 7.3% (10.7%) 97.7 3.00sec 17725 20567 Direct 97.1 9662 19917 12253 25.3%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.68 97.14 0.00 0.00 0.8618 0.0000 1190077.61 1190077.61 0.00 20567.47 20567.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.60 74.74% 9661.62 7636 14014 9667.85 9204 10204 701402 701402 0.00
crit 24.54 25.26% 19916.67 15780 28869 19928.64 18028 23327 488675 488675 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (_empowered) 1813 3.3% 76.9 3.78sec 7042 0 Direct 76.9 7043 0 7043 0.0%  

Stats details: solar_wrath_empowered

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.85 76.85 0.00 0.00 0.0000 0.0000 541230.00 541230.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.85 100.00% 7043.07 4353 16456 7046.85 6000 8321 541230 541230 0.00
 
 

Action details: solar_wrath_empowered

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4656.68
  • base_dd_max:4656.68
  • base_dd_mult:1.00
 
Starsurge 14738 27.1% 63.0 4.76sec 69770 70659 Direct 62.8 55251 113875 69984 25.2%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.05 62.84 0.00 0.00 0.9874 0.0000 4398903.14 4398903.14 0.00 70659.44 70659.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.03 74.84% 55250.99 43106 78606 55283.62 52610 58627 2598361 2598361 0.00
crit 15.81 25.16% 113875.07 90490 161929 113925.57 103331 129463 1800542 1800542 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 2085 3.8% 12.7 23.57sec 48790 50226 Direct 12.7 2727 5580 3453 25.5%  
Periodic 235.1 1941 3994 2458 25.2% 98.5%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 235.09 235.09 0.9715 1.2517 621993.37 621993.37 0.00 2028.41 50225.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.50 74.53% 2726.73 2195 4005 2727.18 2331 3045 25902 25902 0.00
crit 3.25 25.47% 5580.45 4482 8250 5431.56 0 8057 18127 18127 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 175.8 74.77% 1940.52 88 2803 1941.68 1859 2045 341105 341105 0.00
crit 59.3 25.23% 3994.13 53 5775 3996.27 3739 4280 236859 236859 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Storm of the Eternal 537 1.0% 6.0 120.00sec 26415 0 Direct 6.0 21060 43334 26522 24.5%  

Stats details: storm_of_the_eternal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 5.98 0.00 0.00 0.0000 0.0000 158489.19 158489.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.51 75.51% 21059.60 19370 23473 21061.50 19549 23473 95048 95048 0.00
crit 1.46 24.49% 43334.13 39903 48353 35185.01 0 48353 63441 63441 0.00
 
 

Action details: storm_of_the_eternal

Static Values
  • id:303725
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303725
  • name:Storm of the Eternal
  • school:arcane
  • tooltip:
  • description:{$@spelldesc303733=Storm of the Eternal rises for {$303723d=10 seconds} every {$303722d=120 seconds}, dealing ${{$s1=0}*(1+$@versadmg)} Arcane damage {$303724u=3} times to a random enemy within $303725A1 yds. All Storm of the Eternal effects occur simultaneously.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17887.88
  • base_dd_max:17887.88
  • base_dd_mult:1.00
 
Storms Reckoning 922 1.7% 53.2 5.48sec 5168 0 Direct 52.9 4101 8449 5201 25.3%  

Stats details: storms_reckoning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.25 52.91 0.00 0.00 0.0000 0.0000 275203.89 275203.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.52 74.69% 4100.84 3761 4557 4101.26 3964 4280 162066 162066 0.00
crit 13.39 25.31% 8448.97 7747 9388 8450.14 8061 9038 113138 113138 0.00
 
 

Action details: storms_reckoning

Static Values
  • id:300917
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:15.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:300917
  • name:Storms Reckoning
  • school:nature
  • tooltip:
  • description:{$@spelldesc300913=Your spells have a chance to conjure a typhoon that travels towards enemies dealing {$300917s1=0} Nature damage and grant you $300919s~1 Haste for {$300919d=15 seconds}, up to ${$300919s*{$300919u=4}} Haste. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3473.28
  • base_dd_max:3473.28
  • base_dd_mult:1.00
 
Streaking Star 6995 12.8% 94.5 2.97sec 21997 0 Direct 94.5 17378 35814 21999 25.1%  

Stats details: streaking_star

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.45 94.45 0.00 0.00 0.0000 0.0000 2077611.31 2077611.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.79 74.94% 17378.31 15764 19102 17379.47 16754 18234 1230105 1230105 0.00
crit 23.67 25.06% 35814.05 32473 39351 35815.64 34368 37642 847506 847506 0.00
 
 

Action details: streaking_star

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3552 6.5% 17.4 17.20sec 61050 63098 Direct 17.4 4462 9218 5665 25.3%  
Periodic 236.5 3213 6613 4066 25.1% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.36 17.36 236.49 236.49 0.9676 1.2511 1059981.24 1059981.24 0.00 3389.93 63097.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.98 74.73% 4461.75 3524 6408 4463.39 4046 4887 57890 57890 0.00
crit 4.39 25.27% 9217.59 7335 13200 9142.16 0 12180 40430 40430 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 177.2 74.91% 3213.41 14 4646 3215.02 3091 3352 569223 569223 0.00
crit 59.3 25.09% 6613.05 51 9570 6617.88 6169 7146 392438 392438 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Undulating Tides 1843 3.4% 53.6 5.55sec 10260 0 Direct 53.4 8122 16745 10299 25.2%  

Stats details: undulating_tides

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.62 53.43 0.00 0.00 0.0000 0.0000 550187.90 550187.90 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.94 74.76% 8121.66 7449 9027 8122.06 7909 8478 324389 324389 0.00
crit 13.48 25.24% 16745.26 15345 18595 16747.38 16010 17984 225799 225799 0.00
 
 

Action details: undulating_tides

Static Values
  • id:303389
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303389
  • name:Undulating Tides
  • school:frost
  • tooltip:
  • description:{$@spelldesc303008=Your damaging spells and abilities have a chance to crash a wave upon your target for {$s1=1870} Frost damage. When your health drops below {$s2=50}%, gain a shield absorbing {$s3=14665} damage within {$303390d=8 seconds}. When this occurs, Undulating Tides cannot trigger again for {$s4=45} sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6879.00
  • base_dd_max:6879.00
  • base_dd_mult:1.00
 
pet - guardian_of_azeroth 12771 / 2597
Azerite Spike 11370 4.2% 61.2 3.46sec 11148 11577 Direct 61.2 8899 17800 11149 25.3%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.19 61.19 0.00 0.00 0.9629 0.0000 682203.32 682203.32 0.00 11577.49 11577.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.73 74.73% 8899.33 8233 9070 8899.22 8695 9013 406976 406976 0.00
crit 15.46 25.27% 17799.87 16466 18139 17801.07 17390 18092 275227 275227 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295856
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295856
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:Strike your target with a shard of Azerite, dealing {$s1=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7602.61
  • base_dd_max:7602.61
  • base_dd_mult:1.00
 
Azerite Volley 1401 0.5% 6.0 39.27sec 14008 0 Direct 6.0 11160 22310 14008 25.5%  

Stats details: azerite_volley

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 84048.01 84048.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.47 74.45% 11159.81 10805 11336 11159.93 10871 11336 49853 49853 0.00
crit 1.53 25.55% 22309.78 21610 22672 18382.47 0 22672 34195 34195 0.00
 
 

Action details: azerite_volley

Static Values
  • id:303351
  • school:flamestrike
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303351
  • name:Azerite Volley
  • school:flamestrike
  • tooltip:
  • description:{$@spelldesc295841=Every $303347t1 sec, the Guardian of Azeroth will launch of volley of Azerite Spikes at the target area, dealing {$s1=2287} damage to all enemies near its target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9502.90
  • base_dd_max:9502.90
  • base_dd_mult:1.00
 
Simple Action Stats Execute Interval
azsharas
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:azsharas
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.58sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.44sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8292 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Greater Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:298837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:azsharas
  • harmful:false
  • if_expr:
 
Well Fed (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:297039
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:azsharas
  • harmful:false
  • if_expr:
 
Guardian of Azeroth 2.0 180.36sec

Stats details: guardian_of_azeroth

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9656 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: guardian_of_azeroth

Static Values
  • id:295840
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
Spelldata
  • id:295840
  • name:Guardian of Azeroth
  • school:physical
  • tooltip:
  • description:Call upon Azeroth to summon a Guardian of Azeroth for {$300091d=30 seconds} who impales your target with spikes of Azerite every 2 sec that deal ${$295834m1*(1+$@versadmg)} Fire damage.$?a295841[ Every $303347t1 sec, the Guardian launches a volley of Azerite Spikes at its target, dealing {$295841s1=2287} Fire damage to all nearby enemies.][]$?a295843[ Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.][]
 
Latent Arcana 2.0 120.33sec

Stats details: latent_arcana

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 0.00 7.91 0.00 3.9659 1.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: latent_arcana

Static Values
  • id:296971
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:296971
  • name:Latent Arcana
  • school:arcane
  • tooltip:Infusing your body with arcane energies.
  • description:{$@spelldesc296962=Channel latent magic for up to {$296971d=4 seconds}, increasing your primary stat by {$s1=954}. The duration is extended for each second spent channeling, up to $M4 sec.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Potion of Unbridled Fury (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:300714
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.4 55.4 42.9sec 4.8sec 93.13% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.76%
  • arcanic_pulsar_2:10.35%
  • arcanic_pulsar_3:11.28%
  • arcanic_pulsar_4:11.04%
  • arcanic_pulsar_5:12.24%
  • arcanic_pulsar_6:10.44%
  • arcanic_pulsar_7:11.52%
  • arcanic_pulsar_8:14.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.5sec 182.5sec 8.13% 12.55% 0.0(0.0) 2.0

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.56% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 7.9 0.0 39.4sec 39.4sec 26.43% 33.74% 0.0(0.0) 7.7

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Greater Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_greater_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:360.00

Stack Uptimes

  • greater_flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298837
  • name:Greater Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=360} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Guardian of Azeroth 2.0 59.2 180.6sec 3.5sec 19.47% 0.00% 51.2(51.2) 0.0

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_guardian_of_azeroth
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • guardian_of_azeroth_1:0.85%
  • guardian_of_azeroth_2:0.77%
  • guardian_of_azeroth_3:0.69%
  • guardian_of_azeroth_4:0.65%
  • guardian_of_azeroth_5:16.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295855
  • name:Guardian of Azeroth
  • tooltip:Haste increased by {$s1=2}%.
  • description:{$@spelldesc295843=Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.}
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Highborne Compendium of Storms 2.9 50.4 93.9sec 5.5sec 97.36% 0.00% 42.5(42.5) 1.9

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_highborne_compendium_of_storms
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Highborne Compendium of Storms

Stat Buff details

  • stat:haste_rating
  • amount:64.39

Stack Uptimes

  • highborne_compendium_of_storms_1:5.16%
  • highborne_compendium_of_storms_2:4.66%
  • highborne_compendium_of_storms_3:4.39%
  • highborne_compendium_of_storms_4:83.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:300919
  • name:Highborne Compendium of Storms
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc300913=Your spells have a chance to conjure a typhoon that travels towards enemies dealing {$300917s1=0} Nature damage and grant you $300919s~1 Haste for {$300919d=15 seconds}, up to ${$300919s*{$300919u=4}} Haste. }
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Latent Arcana 3.0 0.0 122.3sec 120.3sec 28.61% 0.00% 0.0(0.0) 2.7

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_latent_arcana
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:3353.04

Stack Uptimes

  • latent_arcana_1:28.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:296962
  • name:Latent Arcana
  • tooltip:Primary stat increased by $w1.
  • description:Channel latent magic for up to {$296971d=4 seconds}, increasing your primary stat by {$s1=954}. The duration is extended for each second spent channeling, up to $M4 sec.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Lifeblood 108.4 0.0 150.5sec 2.7sec 98.57% 0.00% 102.3(110.7) 0.0

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_lifeblood
  • max_stacks:4
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:229.17

Stack Uptimes

  • lifeblood_1:1.19%
  • lifeblood_2:1.16%
  • lifeblood_3:1.96%
  • lifeblood_4:94.25%

Trigger Attempt Success

  • trigger_pct:92.20%

Spelldata details

  • id:295137
  • name:Lifeblood
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by ${$w1+$w2+$w3}.
  • description:{$@spelldesc295078=Every {$s4=18}-{$s1=25} sec, a Lifeblood Shard erupts from the nearby ground for {$295114d=12 seconds}.$?!s295186&a295078[ $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within ${$m2*(1+($295160m1/100))} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.][]}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 36.7 45.8 8.2sec 3.6sec 80.70% 99.57% 1.6(1.6) 0.0

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:37.47%
  • lunar_empowerment_2:30.82%
  • lunar_empowerment_3:12.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (mechdowels_big_mech) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_mechdowels_big_mech
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:93.00

Stack Uptimes

  • mechdowels_big_mech_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297039
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=93} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overclocking Bit Band 17.7 0.0 17.3sec 17.3sec 86.70% 0.00% 0.0(0.0) 16.8

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_overclocking_bit_band
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:160.00

Stack Uptimes

  • overclocking_bit_band_1:86.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:301886
  • name:Overclocking Bit Band
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc300126=...then you gain {$s1=0} Haste for {$s2=15} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 4.0 63.4sec 31.7sec 50.62% 0.00% 4.0(54.5) 0.0

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.40%
  • overwhelming_power_2:1.45%
  • overwhelming_power_3:1.49%
  • overwhelming_power_4:1.54%
  • overwhelming_power_5:1.59%
  • overwhelming_power_6:1.64%
  • overwhelming_power_7:1.69%
  • overwhelming_power_8:1.74%
  • overwhelming_power_9:1.80%
  • overwhelming_power_10:1.86%
  • overwhelming_power_11:1.92%
  • overwhelming_power_12:1.98%
  • overwhelming_power_13:2.04%
  • overwhelming_power_14:2.10%
  • overwhelming_power_15:2.16%
  • overwhelming_power_16:2.23%
  • overwhelming_power_17:2.30%
  • overwhelming_power_18:2.37%
  • overwhelming_power_19:2.44%
  • overwhelming_power_20:2.52%
  • overwhelming_power_21:2.61%
  • overwhelming_power_22:2.69%
  • overwhelming_power_23:2.78%
  • overwhelming_power_24:2.86%
  • overwhelming_power_25:1.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Unbridled Fury 2.0 0.0 189.0sec 0.0sec 39.88% 0.00% 0.0(0.0) 1.9

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_potion_of_unbridled_fury
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • potion_of_unbridled_fury_1:39.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:300714
  • name:Potion of Unbridled Fury
  • tooltip:Chance to deal an extra {$300717s1=3600} Fire damage to your current target.
  • description:Fill yourself with unbridled energy, giving your offensive spells and attacks a chance to do an additional {$300717s1=3600} Fire damage to your target. Lasts {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Prodigy's Potency 1.0 43.4 0.0sec 6.6sec 98.13% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_prodigys_potency
  • max_stacks:999
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prodigys_potency_1:1.51%
  • prodigys_potency_2:1.41%
  • prodigys_potency_3:1.51%
  • prodigys_potency_4:1.55%
  • prodigys_potency_5:1.74%
  • prodigys_potency_6:1.96%
  • prodigys_potency_7:1.96%
  • prodigys_potency_8:2.11%
  • prodigys_potency_9:2.29%
  • prodigys_potency_10:2.45%
  • prodigys_potency_11:2.36%
  • prodigys_potency_12:2.50%
  • prodigys_potency_13:2.51%
  • prodigys_potency_14:2.42%
  • prodigys_potency_15:2.60%
  • prodigys_potency_16:2.56%
  • prodigys_potency_17:2.47%
  • prodigys_potency_18:2.51%
  • prodigys_potency_19:2.46%
  • prodigys_potency_20:2.60%
  • prodigys_potency_21:2.39%
  • prodigys_potency_22:2.40%
  • prodigys_potency_23:2.42%
  • prodigys_potency_24:2.50%
  • prodigys_potency_25:2.29%
  • prodigys_potency_26:2.26%
  • prodigys_potency_27:2.25%
  • prodigys_potency_28:2.33%
  • prodigys_potency_29:2.28%
  • prodigys_potency_30:2.24%
  • prodigys_potency_31:2.12%
  • prodigys_potency_32:2.09%
  • prodigys_potency_33:2.17%
  • prodigys_potency_34:2.13%
  • prodigys_potency_35:2.20%
  • prodigys_potency_36:2.12%
  • prodigys_potency_37:1.98%
  • prodigys_potency_38:1.93%
  • prodigys_potency_39:1.88%
  • prodigys_potency_40:1.64%
  • prodigys_potency_41:1.59%
  • prodigys_potency_42:1.34%
  • prodigys_potency_43:1.29%
  • prodigys_potency_44:1.11%
  • prodigys_potency_45:1.00%
  • prodigys_potency_46:0.85%
  • prodigys_potency_47:0.78%
  • prodigys_potency_48:0.65%
  • prodigys_potency_49:0.58%
  • prodigys_potency_50:0.44%
  • prodigys_potency_51:0.32%
  • prodigys_potency_52:0.30%
  • prodigys_potency_53:0.21%
  • prodigys_potency_54:0.18%
  • prodigys_potency_55:0.11%
  • prodigys_potency_56:0.09%
  • prodigys_potency_57:0.08%
  • prodigys_potency_58:0.07%
  • prodigys_potency_59:0.05%
  • prodigys_potency_60:0.05%
  • prodigys_potency_61:0.03%
  • prodigys_potency_62:0.04%
  • prodigys_potency_63:0.02%
  • prodigys_potency_64:0.02%
  • prodigys_potency_65:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:303017
  • name:Prodigy's Potency
  • tooltip:$w1 damage and healing stored.
  • description:
  • max_stacks:999
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
Solar Empowerment 26.9 52.3 11.1sec 3.8sec 84.48% 79.29% 0.2(0.2) 0.0

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:29.69%
  • solar_empowerment_2:38.07%
  • solar_empowerment_3:16.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 47.9 20.4sec 4.8sec 97.13% 96.55% 18.0(18.0) 11.2

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.30%
  • starlord_2:21.69%
  • starlord_3:61.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Strife 2.1 52.2 104.0sec 5.4sec 97.74% 0.00% 39.4(39.4) 1.1

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_strife
  • max_stacks:8
  • duration:14.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:53.82

Stack Uptimes

  • strife_1:3.81%
  • strife_2:3.75%
  • strife_3:3.62%
  • strife_4:3.50%
  • strife_5:3.34%
  • strife_6:3.28%
  • strife_7:3.15%
  • strife_8:73.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:304056
  • name:Strife
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc304081=Your spells and abilities have a chance to increase your Versatility by {$s1=0} for {$304056d=8 seconds}, stacking up to {$304056u=5} times. Being the vicitim of a loss of control or movement impairing effect also grants a stack of Strife.}
  • max_stacks:5
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.4sec 45.0sec 23.72% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
unempowered_solar_wrath 20.4 13.2sec
unempowered_lunar_strike 0.3 99.4sec
wasted_streaking_star 0.2 188.6sec
arcanic_pulsar_proc 6.5 44.2sec

Resources

Resource Usage Type Count Total Average RPE APR
azsharas
starsurge Astral Power 63.0 2522.0 40.0 40.0 1744.2
Resource Gains Type Count Total Average Overflow
celestial_alignment Astral Power 2.00 80.00 (3.22%) 40.00 0.00 0.00%
sunfire Astral Power 17.36 52.08 (2.10%) 3.00 0.00 0.00%
shooting_stars Astral Power 47.43 189.67 (7.63%) 4.00 0.06 0.03%
moonfire Astral Power 14.06 42.18 (1.70%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.75 102.00 (4.10%) 8.00 0.00 0.00%
lunar_strike Astral Power 79.97 959.58 (38.62%) 12.00 0.03 0.00%
solar_wrath Astral Power 97.69 781.48 (31.45%) 8.00 0.03 0.00%
natures_balance Astral Power 399.02 199.49 (8.03%) 0.50 0.03 0.01%
arcanic_pulsar Astral Power 6.53 78.39 (3.15%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.31 8.44
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.59 1.00 77.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data azsharas Fight Length
Count 1192
Mean 298.89
Minimum 240.09
Maximum 359.91
Spread ( max - min ) 119.82
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data azsharas Damage Per Second
Count 1192
Mean 54460.75
Minimum 49219.37
Maximum 60519.26
Spread ( max - min ) 11299.89
Range [ ( max - min ) / 2 * 100% ] 10.37%
Standard Deviation 1835.1358
5th Percentile 51566.40
95th Percentile 57467.31
( 95th Percentile - 5th Percentile ) 5900.91
Mean Distribution
Standard Deviation 53.1533
95.00% Confidence Intervall ( 54356.57 - 54564.93 )
Normalized 95.00% Confidence Intervall ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4362
0.1 Scale Factor Error with Delta=300 28749
0.05 Scale Factor Error with Delta=300 114996
0.01 Scale Factor Error with Delta=300 2874883
Priority Target DPS
Sample Data azsharas Priority Target Damage Per Second
Count 1192
Mean 54460.75
Minimum 49219.37
Maximum 60519.26
Spread ( max - min ) 11299.89
Range [ ( max - min ) / 2 * 100% ] 10.37%
Standard Deviation 1835.1358
5th Percentile 51566.40
95th Percentile 57467.31
( 95th Percentile - 5th Percentile ) 5900.91
Mean Distribution
Standard Deviation 53.1533
95.00% Confidence Intervall ( 54356.57 - 54564.93 )
Normalized 95.00% Confidence Intervall ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4362
0.1 Scale Factor Error with Delta=300 28749
0.05 Scale Factor Error with Delta=300 114996
0.01 Scale Factor Error with Delta=300 2874883
DPS(e)
Sample Data azsharas Damage Per Second (Effective)
Count 1192
Mean 54460.75
Minimum 49219.37
Maximum 60519.26
Spread ( max - min ) 11299.89
Range [ ( max - min ) / 2 * 100% ] 10.37%
Damage
Sample Data azsharas Damage
Count 1192
Mean 15465013.41
Minimum 12273943.81
Maximum 18742436.97
Spread ( max - min ) 6468493.17
Range [ ( max - min ) / 2 * 100% ] 20.91%
DTPS
Sample Data azsharas Damage Taken Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data azsharas Healing Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data azsharas Healing Per Second (Effective)
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data azsharas Heal
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data azsharas Healing Taken Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data azsharas Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data azsharasTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data azsharas Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 use_item,name=azsharas_font_of_power
D 0.00 potion
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6
F 2.00 berserking,if=buff.ca_inc.up
G 2.00 use_item,name=azsharas_font_of_power,if=equipped.169314&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
H 2.00 guardian_of_azeroth,if=(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
0.00 use_item,name=tidestorm_codex,if=equipped.165576
0.00 use_item,name=pocketsized_computation_device,if=equipped.167555&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
0.00 use_item,name=shiver_venom_relic,if=equipped.168905&cooldown.ca_inc.remains>30&!buff.ca_inc.up
0.00 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(!talent.stellar_flare.enabled|dot.stellar_flare.remains>10)&!buff.ca_inc.up&(astral_power<25|cooldown.ca_inc.remains>30)
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 focused_azerite_beam
0.00 thorns
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(buff.memory_of_lucid_dreams.up|ap_check)&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)
I 2.00 celestial_alignment,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 3.02 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 63.05 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.21 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 3.01 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.91 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.05 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.75 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 80.32 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 97.95 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.23 sunfire

Sample Sequence

0123456789ACDKONPHQIFKRKRQKRQRKRNRQORQRKPRQKRQKQQRQRRKRKRKRQRLQOQKQKRPQRKRNQRQKRQQRKORQKRQNPKRQRKRQQQRKOQRKNRQRKPRQQRRRQKKRNOQRQKRQKRQPQRGKNRQKRMQKQQRKRQNPRJKQQKORQKRQRKRQNRQRKKPRQRKRMQKQQNQRRRRQKHIEFKRPRQKORQKNRQRKRQRQRJKRKRQKRQKRLPQOKQQQRRQRKQKQQNRKRQOPRQGKRQNRQRKQQKRQKPRQRQKRQKR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask azsharas 58.0/100: 58% astral_power
Pre precombat 1 food azsharas 58.0/100: 58% astral_power
Pre precombat 2 augmentation azsharas 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C use_item_azsharas_font_of_power Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D potion Fluffy_Pillow 58.0/100: 58% astral_power latent_arcana
0:00.000 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power latent_arcana, potion_of_unbridled_fury
0:01.209 default O moonfire Fluffy_Pillow 18.5/100: 19% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, latent_arcana, potion_of_unbridled_fury
0:02.114 default N sunfire Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, latent_arcana, potion_of_unbridled_fury
0:03.016 default P stellar_flare Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, latent_arcana, potion_of_unbridled_fury
0:03.903 default H guardian_of_azeroth Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms, potion_of_unbridled_fury
0:04.785 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power bloodlust, lifeblood, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms, potion_of_unbridled_fury
0:05.908 default I celestial_alignment Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, lifeblood, guardian_of_azeroth, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms, strife, potion_of_unbridled_fury
0:06.663 default F berserking Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, lifeblood(2), guardian_of_azeroth(2), arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(2), strife, potion_of_unbridled_fury
0:06.663 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, berserking, lifeblood(2), guardian_of_azeroth(2), arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(2), strife, potion_of_unbridled_fury
0:07.417 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(3), arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(2), strife, potion_of_unbridled_fury
0:08.171 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(2), prodigys_potency, strife, potion_of_unbridled_fury
0:08.925 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(2), prodigys_potency, strife(2), potion_of_unbridled_fury
0:09.678 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(3), prodigys_potency, strife(2), potion_of_unbridled_fury
0:10.433 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency, strife(2), potion_of_unbridled_fury
0:11.187 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency, strife(2), potion_of_unbridled_fury
0:11.943 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency, strife(2), potion_of_unbridled_fury
0:12.700 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency, strife(2), potion_of_unbridled_fury
0:13.455 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency, strife(2), potion_of_unbridled_fury
0:14.209 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(2), strife(2), potion_of_unbridled_fury
0:14.964 default N sunfire Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(2), strife(2), potion_of_unbridled_fury
0:15.717 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(2), strife(2), potion_of_unbridled_fury
0:16.471 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:17.225 default O moonfire Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(3), strife(3), potion_of_unbridled_fury
0:17.981 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(3), strife(3), potion_of_unbridled_fury
0:18.737 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(3), strife(3), potion_of_unbridled_fury
0:19.557 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(4), strife(3), potion_of_unbridled_fury
0:20.311 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(4), strife(3), potion_of_unbridled_fury
0:21.067 default P stellar_flare Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(4), strife(4), potion_of_unbridled_fury
0:21.820 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(4), strife(4), potion_of_unbridled_fury
0:22.575 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(4), strife(4), potion_of_unbridled_fury
0:23.443 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(4), strife(4), potion_of_unbridled_fury
0:24.197 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(5), strife(4), potion_of_unbridled_fury
0:24.953 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(5), overwhelming_power(25), strife(4), potion_of_unbridled_fury
0:25.730 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(5), overwhelming_power(24), strife(5), potion_of_unbridled_fury
0:26.483 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(5), overwhelming_power(23), strife(5), potion_of_unbridled_fury
0:27.355 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(22), strife(5), potion_of_unbridled_fury
0:28.231 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(21), strife(5), potion_of_unbridled_fury
0:28.986 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(21), strife(5), potion_of_unbridled_fury
0:29.865 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(20), strife(5), potion_of_unbridled_fury
0:30.618 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(19), strife(5), potion_of_unbridled_fury
0:31.371 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(18), strife(5), potion_of_unbridled_fury
0:32.126 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(17), strife(5), potion_of_unbridled_fury
0:32.880 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(17), strife(5), potion_of_unbridled_fury
0:33.635 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(16), strife(6), potion_of_unbridled_fury
0:34.389 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(15), strife(6), potion_of_unbridled_fury
0:35.145 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(8), overwhelming_power(14), strife(6), potion_of_unbridled_fury
0:35.900 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(8), overwhelming_power(14), strife(6), potion_of_unbridled_fury
0:36.778 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(13), strife(6), potion_of_unbridled_fury
0:37.533 default L sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(12), strife(6), potion_of_unbridled_fury
0:38.287 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(11), strife(7), potion_of_unbridled_fury
0:39.288 default O moonfire Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(10), strife(7), potion_of_unbridled_fury
0:40.074 default Q lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(9), strife(7), potion_of_unbridled_fury
0:41.079 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(8), strife(7), potion_of_unbridled_fury
0:42.200 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(7), strife(8), potion_of_unbridled_fury
0:43.592 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(6), strife(8), potion_of_unbridled_fury
0:44.689 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(5), strife(8), potion_of_unbridled_fury
0:45.601 default P stellar_flare Fluffy_Pillow 10.0/100: 10% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(4), strife(8), potion_of_unbridled_fury
0:46.675 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(3), strife(8), potion_of_unbridled_fury
0:48.047 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power, strife(8), potion_of_unbridled_fury
0:48.969 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power, strife(8), potion_of_unbridled_fury
0:50.054 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), strife(8), potion_of_unbridled_fury
0:50.953 default N sunfire Fluffy_Pillow 17.5/100: 18% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), strife(8), potion_of_unbridled_fury
0:52.011 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(10), strife(8), potion_of_unbridled_fury
0:53.384 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(10), strife(8), potion_of_unbridled_fury
0:54.299 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(10), strife(8), potion_of_unbridled_fury
0:55.670 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(10), strife(8), potion_of_unbridled_fury
0:56.748 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), strife(8), potion_of_unbridled_fury
0:57.646 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), strife(8), potion_of_unbridled_fury
0:58.994 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), strife(8)
1:00.341 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), strife(8)
1:01.240 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), strife(8)
1:02.394 default O moonfire Fluffy_Pillow 24.5/100: 25% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), strife(8)
1:03.513 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:04.466 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:05.893 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:07.014 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:07.941 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:09.326 default N sunfire Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:10.414 default P stellar_flare Fluffy_Pillow 35.5/100: 36% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(13), strife(8)
1:11.501 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), highborne_compendium_of_storms(4), prodigys_potency(14), strife(8)
1:12.610 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), strife(8)
1:13.395 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), strife(8)
1:14.568 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14)
1:15.350 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14)
1:16.271 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14)
1:17.053 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15)
1:18.226 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15)
1:19.573 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, prodigys_potency(15), strife
1:20.961 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power lifeblood(4), arcanic_pulsar, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(16), strife
1:21.881 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power lifeblood(4), arcanic_pulsar, solar_empowerment, overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(16), strife
1:23.060 default O moonfire Fluffy_Pillow 28.0/100: 28% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(16), strife
1:24.196 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(17), strife(2)
1:25.642 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(18), strife(2)
1:26.609 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(18), strife(2)
1:27.744 default N sunfire Fluffy_Pillow 14.0/100: 14% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(18), strife(3)
1:28.848 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(18), strife(3)
1:29.787 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(18), strife(3)
1:31.192 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(18), strife(4)
1:32.131 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(18), strife(4)
1:33.235 default P stellar_flare Fluffy_Pillow 9.0/100: 9% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(18), strife(4)
1:34.310 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(18), strife(5)
1:35.223 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(18), strife(5)
1:36.592 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(19), strife(5)
1:37.960 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(3), starlord(3), overclocking_bit_band, prodigys_potency(19), strife(6)
1:38.885 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms, torrent_of_elements, prodigys_potency(19), strife(6)
1:39.803 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms, torrent_of_elements, prodigys_potency(19), strife(6)
1:40.722 default Q lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms, torrent_of_elements, prodigys_potency(19), strife(6)
1:42.099 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, highborne_compendium_of_storms(2), torrent_of_elements, prodigys_potency(20), overwhelming_power(24), strife(6)
1:43.198 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(3), torrent_of_elements, prodigys_potency(20), overwhelming_power(23), strife(7)
1:44.242 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(3), torrent_of_elements, prodigys_potency(20), overwhelming_power(22), strife(7)
1:45.108 default N sunfire Fluffy_Pillow 33.0/100: 33% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(3), torrent_of_elements, prodigys_potency(20), overwhelming_power(21), strife(7)
1:46.127 default O moonfire Fluffy_Pillow 40.5/100: 41% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(3), torrent_of_elements, prodigys_potency(20), overwhelming_power(20), strife(8)
1:47.152 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(3), torrent_of_elements, prodigys_potency(20), overwhelming_power(19), strife(8)
1:48.460 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(20), overwhelming_power(18), strife(8)
1:49.330 default Q lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(20), overwhelming_power(17), strife(8)
1:50.638 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(20), overwhelming_power(16), strife(8)
1:51.669 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(20), overwhelming_power(15), strife(8)
1:52.525 default Q lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(21), overwhelming_power(14), strife(8)
1:53.810 default K starsurge Fluffy_Pillow 68.5/100: 69% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), overwhelming_power(13), strife(8)
1:54.821 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), overwhelming_power(12), strife(8)
1:55.683 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), overwhelming_power(11), strife(8)
1:56.980 default P stellar_flare Fluffy_Pillow 50.5/100: 51% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), overwhelming_power(10), strife(8)
1:58.003 default Q lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(21), overwhelming_power(8), strife(8)
1:59.336 default R solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(21), overwhelming_power(7), strife(8)
2:00.230 default G use_item_azsharas_font_of_power Fluffy_Pillow 85.0/100: 85% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), overwhelming_power(6), strife(8)
2:04.447 default K starsurge Fluffy_Pillow 99.5/100: 100% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(21), overwhelming_power(2), strife(8)
2:05.593 default N sunfire Fluffy_Pillow 72.5/100: 73% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(21), overwhelming_power, strife(8)
2:06.566 default R solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(22), strife(8)
2:07.394 default Q lunar_strike Fluffy_Pillow 84.5/100: 85% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(22), strife(8)
2:08.637 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), strife(8)
2:09.612 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), strife(8)
2:10.418 default M moonfire Fluffy_Pillow 69.0/100: 69% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), strife(8)
2:11.365 default Q lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), strife(8)
2:12.751 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(25), strife(8)
2:13.841 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(25), strife(8)
2:15.188 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(25), strife(8)
2:16.535 default R solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(25), strife(8)
2:17.452 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(25), strife(8)
2:18.531 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(25), strife(8)
2:19.429 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(25), strife(8)
2:20.777 default N sunfire Fluffy_Pillow 71.0/100: 71% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8)
2:21.837 default P stellar_flare Fluffy_Pillow 75.0/100: 75% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8)
2:22.895 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8)
2:23.794 default J cancel_buff Fluffy_Pillow 92.0/100: 92% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8)
2:23.794 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8)
2:24.947 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8)
2:26.374 default Q lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8)
2:27.800 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8)
2:28.920 default O moonfire Fluffy_Pillow 43.5/100: 44% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8)
2:30.008 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8)
2:30.933 default Q lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8)
2:32.320 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8)
2:33.407 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8)
2:34.324 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(27), strife(8)
2:35.698 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(27), strife(8)
2:36.616 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), strife(8)
2:37.695 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), strife(8)
2:38.593 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), strife(8)
2:39.939 default N sunfire Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(28), strife(8)
2:40.999 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(29), strife(8)
2:41.899 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(29), strife(8)
2:43.247 default R solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(29), strife(8)
2:44.145 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(29), strife(8)
2:45.300 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(29), strife(8)
2:46.420 default P stellar_flare Fluffy_Pillow 17.0/100: 17% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(29), strife(8)
2:47.367 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(29), overwhelming_power(25), strife(8)
2:48.120 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(29), overwhelming_power(24), strife(8)
2:49.233 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(29), overwhelming_power(23), strife(8)
2:49.987 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(29), overwhelming_power(23), strife(8)
2:50.862 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(29), overwhelming_power(22), strife(8)
2:51.618 default M moonfire Fluffy_Pillow 24.5/100: 25% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(29), overwhelming_power(21), strife(8)
2:52.488 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(29), overwhelming_power(20), strife(8)
2:53.770 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(30), overwhelming_power(19), strife(8)
2:54.762 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(30), overwhelming_power(18), strife(8)
2:56.031 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), overwhelming_power(16), strife(8)
2:57.308 default N sunfire Fluffy_Pillow 27.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(32), overwhelming_power(15), strife(8)
2:58.313 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(32), overwhelming_power(14), strife(8)
2:59.597 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(33), overwhelming_power(13), strife(8)
3:00.458 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(33), overwhelming_power(12), strife(8)
3:01.320 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power lifeblood(4), arcanic_pulsar(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(33), overwhelming_power(11), strife(8)
3:02.341 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power lifeblood(4), arcanic_pulsar(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(33), overwhelming_power(10), strife(8)
3:03.366 default Q lunar_strike Fluffy_Pillow 78.5/100: 79% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(33), overwhelming_power(9), strife(8)
3:04.673 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power lifeblood(4), arcanic_pulsar(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(34), overwhelming_power(8), strife(8)
3:05.794 default H guardian_of_azeroth Fluffy_Pillow 52.0/100: 52% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(34), overwhelming_power(7), strife(8)
3:06.886 default I celestial_alignment Fluffy_Pillow 53.0/100: 53% astral_power lifeblood(4), arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(34), overwhelming_power(6), strife(8)
3:07.840 default E potion Fluffy_Pillow 93.5/100: 94% astral_power lifeblood(4), guardian_of_azeroth, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(34), overwhelming_power(5), strife(8)
3:07.840 default F berserking Fluffy_Pillow 93.5/100: 94% astral_power lifeblood(4), guardian_of_azeroth, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(34), overwhelming_power(5), strife(8), potion_of_unbridled_fury
3:07.840 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power berserking, lifeblood(4), guardian_of_azeroth, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(34), overwhelming_power(5), strife(8), potion_of_unbridled_fury
3:08.694 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power berserking, lifeblood(4), guardian_of_azeroth(2), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(35), overwhelming_power(4), strife(8), potion_of_unbridled_fury
3:09.449 default P stellar_flare Fluffy_Pillow 66.5/100: 67% astral_power berserking, lifeblood(4), guardian_of_azeroth(2), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(35), overwhelming_power(3), strife(8), potion_of_unbridled_fury
3:10.282 default R solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power berserking, lifeblood(4), guardian_of_azeroth(3), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(35), overwhelming_power(24), strife(8), potion_of_unbridled_fury
3:11.035 default Q lunar_strike Fluffy_Pillow 83.5/100: 84% astral_power berserking, lifeblood(4), guardian_of_azeroth(4), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(35), overwhelming_power(23), strife(8), potion_of_unbridled_fury
3:11.973 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(36), overwhelming_power(23), strife(8), potion_of_unbridled_fury
3:12.727 default O moonfire Fluffy_Pillow 60.5/100: 61% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(36), overwhelming_power(22), strife(8), potion_of_unbridled_fury
3:13.481 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(36), overwhelming_power(21), strife(8), potion_of_unbridled_fury
3:14.235 default Q lunar_strike Fluffy_Pillow 72.5/100: 73% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(36), overwhelming_power(20), strife(8), potion_of_unbridled_fury
3:15.140 default K starsurge Fluffy_Pillow 85.5/100: 86% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(19), strife(8), potion_of_unbridled_fury
3:15.894 default N sunfire Fluffy_Pillow 46.0/100: 46% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(19), strife(8), potion_of_unbridled_fury
3:16.648 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(18), strife(8), potion_of_unbridled_fury
3:17.403 default Q lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(17), strife(8), potion_of_unbridled_fury
3:18.320 default R solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(16), strife(8), potion_of_unbridled_fury
3:19.076 default K starsurge Fluffy_Pillow 83.0/100: 83% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(38), overwhelming_power(15), strife(8), potion_of_unbridled_fury
3:19.830 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(38), overwhelming_power(15), strife(8), potion_of_unbridled_fury
3:20.584 default Q lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(39), overwhelming_power(14), strife(8), potion_of_unbridled_fury
3:21.601 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(40), overwhelming_power(13), strife(8), potion_of_unbridled_fury
3:22.356 default Q lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(40), overwhelming_power(12), strife(8), potion_of_unbridled_fury
3:23.377 default R solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(40), overwhelming_power(11), strife(8), potion_of_unbridled_fury
3:24.184 default J cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(40), overwhelming_power(10), strife(8), potion_of_unbridled_fury
3:24.184 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(40), overwhelming_power(10), strife(8), potion_of_unbridled_fury
3:25.063 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(40), overwhelming_power(9), strife(8), potion_of_unbridled_fury
3:25.817 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord, highborne_compendium_of_storms(4), prodigys_potency(40), overwhelming_power(9), strife(8), potion_of_unbridled_fury
3:26.692 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), highborne_compendium_of_storms(4), prodigys_potency(40), overwhelming_power(8), strife(8), potion_of_unbridled_fury
3:27.448 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment(3), starlord(2), highborne_compendium_of_storms(4), prodigys_potency(41), overwhelming_power(24), strife(8), potion_of_unbridled_fury
3:28.478 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(42), overwhelming_power(23), strife(8), potion_of_unbridled_fury
3:29.275 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(42), overwhelming_power(22), strife(8), potion_of_unbridled_fury
3:30.029 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(42), overwhelming_power(21), strife(8), potion_of_unbridled_fury
3:31.021 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(43), overwhelming_power(24), strife(8), potion_of_unbridled_fury
3:31.793 default R solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(43), overwhelming_power(24), strife(8), potion_of_unbridled_fury
3:32.548 default L sunfire Fluffy_Pillow 12.0/100: 12% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(43), overwhelming_power(25), strife(8), potion_of_unbridled_fury
3:33.318 default P stellar_flare Fluffy_Pillow 15.5/100: 16% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(43), overwhelming_power(24), strife(8), potion_of_unbridled_fury
3:34.208 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(43), overwhelming_power(23), strife(8), potion_of_unbridled_fury
3:35.343 default O moonfire Fluffy_Pillow 37.0/100: 37% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(43), overwhelming_power(22), strife(8), potion_of_unbridled_fury
3:36.238 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(43), overwhelming_power(21), strife(8), potion_of_unbridled_fury
3:37.224 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(43), overwhelming_power(20), strife(8), potion_of_unbridled_fury
3:38.483 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(43), overwhelming_power(19), strife(8), potion_of_unbridled_fury
3:39.748 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(43), overwhelming_power(18), strife(8), potion_of_unbridled_fury
3:41.017 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(44), overwhelming_power(16), strife(8), potion_of_unbridled_fury
3:41.871 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(44), overwhelming_power(16), strife(8), potion_of_unbridled_fury
3:42.872 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(44), overwhelming_power(15), strife(8), potion_of_unbridled_fury
3:44.150 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(44), overwhelming_power(13), strife(8), potion_of_unbridled_fury
3:45.179 default K starsurge Fluffy_Pillow 78.5/100: 79% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, highborne_compendium_of_storms(4), prodigys_potency(45), overwhelming_power(12), strife(8), potion_of_unbridled_fury
3:46.306 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(45), overwhelming_power(11), strife(8), potion_of_unbridled_fury
3:47.680 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(45), overwhelming_power(10), strife(8), potion_of_unbridled_fury
3:48.764 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(45), overwhelming_power(9), strife(8), potion_of_unbridled_fury
3:50.108 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(45), overwhelming_power(7), strife(8), potion_of_unbridled_fury
3:51.462 default N sunfire Fluffy_Pillow 38.5/100: 39% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(45), overwhelming_power(6), strife(8), potion_of_unbridled_fury
3:52.528 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(45), overwhelming_power(5), strife(8), potion_of_unbridled_fury
3:53.438 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(45), overwhelming_power(4), strife(8), potion_of_unbridled_fury
3:54.513 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(45), overwhelming_power(3), strife(8), potion_of_unbridled_fury
3:55.404 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(46), overwhelming_power(2), strife(8), potion_of_unbridled_fury
3:56.744 default O moonfire Fluffy_Pillow 37.0/100: 37% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(46), overwhelming_power, strife(8), potion_of_unbridled_fury
3:57.798 default P stellar_flare Fluffy_Pillow 41.0/100: 41% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(46), strife(8), potion_of_unbridled_fury
3:58.860 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(47), strife(8), potion_of_unbridled_fury
3:59.758 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(48), strife(8), potion_of_unbridled_fury
4:01.105 default G use_item_azsharas_font_of_power Fluffy_Pillow 71.0/100: 71% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(49), strife(8), potion_of_unbridled_fury
4:05.433 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), latent_arcana, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(50), strife(8), potion_of_unbridled_fury
4:06.608 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(50), strife(8), potion_of_unbridled_fury
4:07.580 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(50), potion_of_unbridled_fury
4:09.005 default N sunfire Fluffy_Pillow 56.5/100: 56% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(50), strife
4:10.126 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(50), strife
4:11.079 default Q lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(51), strife
4:12.505 default R solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(52), strife
4:13.457 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(52), strife
4:14.577 default Q lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(52), strife
4:15.963 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(52), strife(2)
4:17.349 default K starsurge Fluffy_Pillow 81.0/100: 81% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(52), strife(2)
4:18.438 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(52), strife(2)
4:19.221 default Q lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(52), strife(2)
4:20.394 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(52), strife(2)
4:21.314 default P stellar_flare Fluffy_Pillow 35.5/100: 36% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(52), strife(2)
4:22.236 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(52), strife(3)
4:23.019 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(52), strife(3)
4:24.212 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment(2), solar_empowerment(3), starlord(3), latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(52), strife(3)
4:25.130 default Q lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(52), strife(3)
4:26.503 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment, solar_empowerment(2), latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(52), strife(4)
4:27.677 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(52), strife(4)
4:28.629 default Q lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(53), strife(4)
4:30.053 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(53), strife(5)
4:31.174 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, latent_arcana, highborne_compendium_of_storms(4), prodigys_potency(53), strife(5)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16715 15195 12905
Intellect 1467 -3 12229 10676 8704 (5789)
Spirit 0 0 0 0 0
Health 334300 303900 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 12229 10676 0
Crit 25.19% 23.90% 1361
Haste 24.38% 24.38% 1658
Damage / Heal Versatility 3.13% 3.13% 266
ManaReg per Second 2396 640 0
Attack Power 12718 11103 0
Mastery 37.17% 37.17% 1162
Armor 2828 2828 2828
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 435.00
Local Head Shroud of Unmooring Whispers
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
azerite powers: { Streaking Stars, Arcanic Pulsar, Overwhelming Power }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Shoulderpads of Frothing Rage
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
azerite powers: { Streaking Stars, Loyal to the End, Heed My Call }
Local Chest Tunic of the Sycophant
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
azerite powers: { Streaking Stars, Undulating Tides, Gutripper }
Local Waist Vim's Scalecrusher Clasp
ilevel: 425, stats: { 233 Armor, +358 AgiInt, +637 Sta, +102 Crit, +111 Haste }, gems: { +50 Haste }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Akana's Reefstrider Footwraps
ilevel: 425, stats: { 285 Armor, +358 AgiInt, +637 Sta, +102 Mastery, +111 Haste }, gems: { +50 Haste }
Local Wrists Ori's Tidal Wristwraps
ilevel: 425, stats: { 181 Armor, +268 AgiInt, +478 Sta, +87 Vers, +73 Haste }, gems: { +50 Haste }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Overclocking Bit Band
ilevel: 415, stats: { +430 Sta, +388 Haste, +97 Mastery }, enchant: { +60 Crit }
Local Finger2 Logic Loop of Recursion
ilevel: 415, stats: { +430 Sta, +361 Crit, +124 Haste }, enchant: { +60 Crit }
Local Trinket1 Azshara's Font of Power
ilevel: 445, stats: { +218 Crit }
Local Trinket2 Highborne Compendium of Storms
ilevel: 400, stats: { +359 Int }
Local Back Shirakess Drape
ilevel: 425, stats: { 122 Armor, +268 StrAgiInt, +478 Sta, +83 Haste, +77 Mastery }, gems: { +50 Haste }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="azsharas"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
professions=engineering=100/jewelcrafting=100
talents=1000231
azerite_essences=14:3:1/32:3:0/4:3:0

# Default consumables
potion=unbridled_fury
flask=greater_flask_of_endless_fathoms
food=mechdowels_big_mech
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/use_item,name=azsharas_font_of_power
actions.precombat+=/potion

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6
actions+=/berserking,if=buff.ca_inc.up
actions+=/use_item,name=azsharas_font_of_power,if=equipped.169314&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/guardian_of_azeroth,if=(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_item,name=pocketsized_computation_device,if=equipped.167555&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/use_item,name=shiver_venom_relic,if=equipped.168905&cooldown.ca_inc.remains>30&!buff.ca_inc.up
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(!talent.stellar_flare.enabled|dot.stellar_flare.remains>10)&!buff.ca_inc.up&(astral_power<25|cooldown.ca_inc.remains>30)
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/focused_azerite_beam
actions+=/thorns
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(buff.memory_of_lucid_dreams.up|ap_check)&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)
actions+=/celestial_alignment,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=shroud_of_unmooring_whispers,id=168349,ilevel=450,azerite_powers=122/200/30
neck=heart_of_azeroth,id=158075,ilevel=463,azerite_level=65
shoulders=shoulderpads_of_frothing_rage,id=168348,ilevel=450,azerite_powers=122/576/22
back=shirakess_drape,id=169486,ilevel=425,gems=50haste
chest=tunic_of_the_sycophant,id=168350,ilevel=450,azerite_powers=122/575/31
wrists=oris_tidal_wristwraps,id=170305,ilevel=425,gems=50haste
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=vims_scalecrusher_clasp,id=170368,ilevel=425,gems=50haste
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=akanas_reefstrider_footwraps,id=170141,ilevel=425,gems=50haste
finger1=overclocking_bit_band,id=169159,ilevel=415,enchant=60crit
finger2=logic_loop_of_recursion,id=169158,ilevel=415,enchant=60crit
trinket1=azsharas_font_of_power,id=169314,ilevel=445
trinket2=highborne_compendium_of_storms,id=169328,ilevel=400
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=434.87
# gear_stamina=12905
# gear_intellect=8704
# gear_crit_rating=1361
# gear_haste_rating=1658
# gear_mastery_rating=805
# gear_versatility_rating=266
# gear_armor=2828

cyclotronic : 53782 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
53782.2 53782.2 105.2 / 0.196% 7052.9 / 13.1% 6046.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.4 8.3 Astral Power 0.00% 60.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator
Professions
  • engineering: 100
  • jewelcrafting: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
cyclotronic 53782
Azerite Spike 1033 1.9% 17.7 15.57sec 17466 0 Direct 17.6 13887 28609 17482 24.4%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.65 17.64 0.00 0.00 0.0000 0.0000 308277.37 308277.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.33 75.60% 13886.68 12749 15444 13882.67 13287 14834 185161 185161 0.00
crit 4.30 24.40% 28609.28 26263 31815 28234.96 0 31815 123117 123117 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295835
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:90.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295835
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:{$@spelldesc295834=Your spells and abilities have a high chance to impale your target with a spike of Azerite, causing ${$m1*(1+$@versadmg)} Fire damage.$?a295837[ When an Azerite spike deals damage, all damage you deal against that target is increased by {$295838s1=5}% for {$295838d=6 seconds}.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11696.33
  • base_dd_max:11696.33
  • base_dd_mult:1.00
 
Conch Strike 382 0.7% 13.2 22.15sec 8621 0 Direct 13.1 6883 14180 8697 24.9%  

Stats details: conch_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.23 13.11 0.00 0.00 0.0000 0.0000 114070.70 162958.14 30.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.85 75.14% 6883.29 6457 7111 6884.22 6689 7077 67830 96900 30.00
crit 3.26 24.86% 14180.47 13302 14650 13736.75 0 14650 46241 66058 29.07
 
 

Action details: conch_strike

Static Values
  • id:304698
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:304698
  • name:Conch Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc304697=While in Nazjatar or the Eternal Palace, your spells and abilities have a chance to deal Physical damage and increased threat to enemies in a small area around the target. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8462.82
  • base_dd_max:8462.82
  • base_dd_mult:1.00
 
Cyclotronic Blast 2217 4.1% 2.9 121.36sec 223529 141338 Periodic 17.6 29461 60690 37396 25.4% 1.6%

Stats details: cyclotronic_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 17.59 17.59 1.5815 0.2645 657647.61 657647.61 0.00 141338.41 141338.41
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.1 74.64% 29461.32 27342 33123 29451.01 28051 32049 386855 386855 0.00
crit 4.5 25.36% 60690.48 56325 68233 60157.86 0 68233 270792 270792 0.00
 
 

Action details: cyclotronic_blast

Static Values
  • id:293491
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:293491
  • name:Cyclotronic Blast
  • school:arcane
  • tooltip:
  • description:Channel a cyclotronic blast, dealing {$s1=9029} damage every $t1 sec for $D
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:25084.10
  • base_td_mult:1.00
  • dot_duration:2.50
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Blast 588 1.1% 13.2 21.46sec 13302 0 Direct 13.2 10565 21742 13298 24.5%  

Stats details: frost_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.22 13.22 0.00 0.00 0.0000 0.0000 175854.80 175854.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.98 75.52% 10565.19 9687 11735 10564.63 10052 11286 105486 105486 0.00
crit 3.24 24.48% 21742.40 19955 24174 20893.23 0 24174 70369 70369 0.00
 
 

Action details: frost_blast

Static Values
  • id:304645
  • school:frost
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:304645
  • name:Frost Blast
  • school:frost
  • tooltip:Slowed.
  • description:{$@spelldesc304640=While in Nazjatar or the Eternal Palace, your spells and abilities have a chance to deal {$304645s1=0} Frost damage to your target, slowing them for {$304645d=6 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8887.35
  • base_dd_max:8887.35
  • base_dd_mult:1.00
 
Gutripper 537 1.0% 38.2 7.56sec 4185 0 Direct 38.2 3328 6859 4185 24.3%  

Stats details: gutripper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.24 38.24 0.00 0.00 0.0000 0.0000 160026.24 228608.92 30.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.96 75.73% 3328.34 3121 3437 3329.32 3250 3408 96377 137682 30.00
crit 9.28 24.27% 6858.51 6429 7080 6856.16 0 7080 63649 90927 29.97
 
 

Action details: gutripper

Static Values
  • id:269031
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:269031
  • name:Gutripper
  • school:physical
  • tooltip:
  • description:{$@spelldesc266937=Your damaging abilities have a chance to deal {$s1=1112} Physical damage to the target. Gutripper occurs much more often against targets below {$s2=30}% health. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4090.00
  • base_dd_max:4090.00
  • base_dd_mult:1.00
 
Heed My Call 350 (500) 0.7% (0.9%) 8.7 32.18sec 17275 0 Direct 8.7 9635 19843 12081 23.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.65 8.65 0.00 0.00 0.0000 0.0000 104530.25 104530.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.58 76.05% 9635.26 8836 10704 9638.22 9052 10438 63410 63410 0.00
crit 2.07 23.95% 19843.40 18202 22050 17374.48 0 22050 41120 41120 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 150 0.3% 8.7 32.18sec 5196 0 Direct 8.7 4128 8515 5195 24.4%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.65 8.65 0.00 0.00 0.0000 0.0000 44963.70 44963.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.55 75.65% 4127.78 3787 4587 4119.27 0 4587 27020 27020 0.00
crit 2.11 24.35% 8514.68 7801 9450 7549.77 0 9450 17944 17944 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5967 11.1% 79.6 3.62sec 22396 18325 Direct 79.6 17768 36620 22398 24.6%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.58 79.58 0.00 0.00 1.2222 0.0000 1782262.86 1782262.86 0.00 18324.73 18324.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.04 75.45% 17768.38 10482 21883 17773.70 17211 18430 1066803 1066803 0.00
crit 19.54 24.55% 36619.57 21593 45078 36635.72 34185 39234 715460 715460 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2942 5.5% 14.0 21.54sec 62684 64941 Direct 14.0 2949 6074 3729 25.0%  
Periodic 237.4 2760 5687 3480 24.6% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.01 14.01 237.35 237.35 0.9653 1.2502 878265.33 878265.33 0.00 2830.70 64941.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.51 75.03% 2949.15 2392 3620 2948.75 2636 3210 31003 31003 0.00
crit 3.50 24.97% 6073.65 4927 7457 5978.64 0 7457 21249 21249 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.9 75.39% 2760.07 16 3370 2760.72 2693 2864 493893 493893 0.00
crit 58.4 24.61% 5686.62 48 6943 5687.84 5378 6071 332120 332120 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Potion of Unbridled Fury 1440 2.7% 78.4 3.21sec 5421 0 Direct 78.4 4297 8855 5421 24.7%  

Stats details: potion_of_unbridled_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.42 78.42 0.00 0.00 0.0000 0.0000 425095.16 425095.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.07 75.33% 4297.22 3924 4754 4296.66 4150 4552 253829 253829 0.00
crit 19.34 24.67% 8855.15 8084 9793 8856.31 8510 9450 171266 171266 0.00
 
 

Action details: potion_of_unbridled_fury

Static Values
  • id:300717
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:300717
  • name:Potion of Unbridled Fury
  • school:fire
  • tooltip:
  • description:Deal {$s1=3600} Fire damage to your current target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3600.00
  • base_dd_max:3600.00
  • base_dd_mult:1.00
 
Shooting Stars 1067 2.0% 47.1 6.32sec 6760 0 Direct 47.1 5370 11049 6759 24.5%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.13 47.13 0.00 0.00 0.0000 0.0000 318584.58 318584.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.59 75.52% 5369.65 4328 6552 5370.90 5112 5712 191134 191134 0.00
crit 11.54 24.48% 11049.42 8917 13497 11058.46 10033 12490 127451 127451 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3725 (5396) 6.9% (10.1%) 97.8 2.98sec 16482 19078 Direct 98.3 8992 18505 11321 24.5%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.79 98.28 0.00 0.00 0.8639 0.0000 1112627.48 1112627.48 0.00 19078.31 19078.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.22 75.52% 8991.93 7214 10920 8994.95 8733 9352 667383 667383 0.00
crit 24.06 24.48% 18504.70 14861 22495 18509.97 17074 19746 445244 445244 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (_empowered) 1671 3.1% 76.8 3.76sec 6500 0 Direct 76.8 6501 0 6501 0.0%  

Stats details: solar_wrath_empowered

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.77 76.77 0.00 0.00 0.0000 0.0000 499050.69 499050.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.77 100.00% 6500.65 4304 12822 6502.71 5736 7348 499051 499051 0.00
 
 

Action details: solar_wrath_empowered

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9653.25
  • base_dd_max:9653.25
  • base_dd_mult:1.00
 
Starsurge 13636 25.4% 63.1 4.73sec 64499 65255 Direct 62.9 51263 105645 64718 24.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.11 62.91 0.00 0.00 0.9884 0.0000 4070578.80 4070578.80 0.00 65254.55 65254.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.36 75.28% 51262.96 41484 62365 51276.31 49572 53639 2427782 2427782 0.00
crit 15.55 24.72% 105645.23 85457 128471 105661.17 97865 114462 1642796 1642796 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1916 3.6% 12.7 23.58sec 44853 45898 Direct 12.7 2512 5172 3165 24.5%  
Periodic 235.2 1793 3694 2260 24.6% 98.5%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 235.20 235.20 0.9772 1.2513 571843.09 571843.09 0.00 1864.08 45897.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.62 75.48% 2511.73 2062 3121 2511.28 2323 2750 24166 24166 0.00
crit 3.13 24.52% 5172.34 4247 6428 5028.95 0 6428 16175 16175 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 177.4 75.42% 1792.66 79 2184 1793.06 1736 1850 317996 317996 0.00
crit 57.8 24.58% 3693.72 1202 4500 3694.32 3552 3904 213505 213505 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Storm of the Eternal 543 1.0% 6.0 120.00sec 26703 0 Direct 6.0 21190 43629 26808 25.0%  

Stats details: storm_of_the_eternal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 5.98 0.00 0.00 0.0000 0.0000 160218.97 160218.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.48 74.99% 21189.76 19498 23621 21203.75 19826 23621 94990 94990 0.00
crit 1.49 25.01% 43629.45 40167 48658 35575.24 0 48658 65229 65229 0.00
 
 

Action details: storm_of_the_eternal

Static Values
  • id:303725
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303725
  • name:Storm of the Eternal
  • school:arcane
  • tooltip:
  • description:{$@spelldesc303733=Storm of the Eternal rises for {$303723d=10 seconds} every {$303722d=120 seconds}, dealing ${{$s1=0}*(1+$@versadmg)} Arcane damage {$303724u=3} times to a random enemy within $303725A1 yds. All Storm of the Eternal effects occur simultaneously.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17887.88
  • base_dd_max:17887.88
  • base_dd_mult:1.00
 
Storms Reckoning 927 1.7% 53.4 5.54sec 5180 0 Direct 53.1 4125 8498 5214 24.9%  

Stats details: storms_reckoning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.44 53.09 0.00 0.00 0.0000 0.0000 276829.83 276829.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.87 75.10% 4125.43 3786 4586 4125.30 4000 4281 164480 164480 0.00
crit 13.22 24.90% 8497.51 7798 9447 8497.00 8177 9056 112350 112350 0.00
 
 

Action details: storms_reckoning

Static Values
  • id:300917
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:15.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:300917
  • name:Storms Reckoning
  • school:nature
  • tooltip:
  • description:{$@spelldesc300913=Your spells have a chance to conjure a typhoon that travels towards enemies dealing {$300917s1=0} Nature damage and grant you $300919s~1 Haste for {$300919d=15 seconds}, up to ${$300919s*{$300919u=4}} Haste. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3473.28
  • base_dd_max:3473.28
  • base_dd_mult:1.00
 
Streaking Star 7006 13.0% 94.6 2.94sec 22009 0 Direct 94.6 17473 35993 22013 24.5%  

Stats details: streaking_star

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.56 94.56 0.00 0.00 0.0000 0.0000 2081114.15 2081114.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.39 75.50% 17472.94 15868 19223 17470.97 16809 18313 1247265 1247265 0.00
crit 23.17 24.50% 35992.99 32688 39599 35991.64 34371 38766 833849 833849 0.00
 
 

Action details: streaking_star

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3263 6.1% 17.4 17.16sec 56051 58053 Direct 17.4 4056 8346 5121 24.8%  
Periodic 236.5 2964 6110 3742 24.7% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.38 17.38 236.53 236.53 0.9655 1.2504 974124.85 974124.85 0.00 3116.87 58052.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.08 75.24% 4056.23 3299 4993 4056.63 3810 4319 53038 53038 0.00
crit 4.30 24.76% 8345.91 6795 10286 8287.26 0 10286 35913 35913 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.0 75.26% 2963.87 9 3620 2964.48 2860 3066 527573 527573 0.00
crit 58.5 24.74% 6110.07 16 7457 6111.74 5833 6402 357601 357601 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Undulating Tides 1837 3.4% 53.5 5.39sec 10253 0 Direct 53.3 8172 16828 10292 24.5%  

Stats details: undulating_tides

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.49 53.29 0.00 0.00 0.0000 0.0000 548425.29 548425.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.24 75.51% 8171.66 7498 9084 8171.63 7951 8581 328841 328841 0.00
crit 13.05 24.49% 16827.89 15446 18712 16829.92 16064 17787 219584 219584 0.00
 
 

Action details: undulating_tides

Static Values
  • id:303389
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303389
  • name:Undulating Tides
  • school:frost
  • tooltip:
  • description:{$@spelldesc303008=Your damaging spells and abilities have a chance to crash a wave upon your target for {$s1=1870} Frost damage. When your health drops below {$s2=50}%, gain a shield absorbing {$s3=14665} damage within {$303390d=8 seconds}. When this occurs, Undulating Tides cannot trigger again for {$s4=45} sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6879.00
  • base_dd_max:6879.00
  • base_dd_mult:1.00
 
pet - guardian_of_azeroth 12711 / 2585
Azerite Spike 11319 4.2% 61.0 3.48sec 11140 11530 Direct 61.0 8956 17915 11139 24.4%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.96 60.96 0.00 0.00 0.9662 0.0000 679146.40 679146.40 0.00 11529.52 11529.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.10 75.62% 8956.09 8287 9127 8955.99 8783 9069 412900 412900 0.00
crit 14.86 24.38% 17915.03 16575 18254 17914.98 17559 18207 266247 266247 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295856
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295856
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:Strike your target with a shard of Azerite, dealing {$s1=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7602.61
  • base_dd_max:7602.61
  • base_dd_mult:1.00
 
Azerite Volley 1392 0.5% 6.0 39.27sec 13916 0 Direct 6.0 11229 22454 13920 23.9%  

Stats details: azerite_volley

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 83494.04 83494.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.56 76.06% 11228.89 10876 11408 11228.98 10910 11408 51246 51246 0.00
crit 1.44 23.94% 22454.36 21753 22815 18119.93 0 22815 32248 32248 0.00
 
 

Action details: azerite_volley

Static Values
  • id:303351
  • school:flamestrike
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303351
  • name:Azerite Volley
  • school:flamestrike
  • tooltip:
  • description:{$@spelldesc295841=Every $303347t1 sec, the Guardian of Azeroth will launch of volley of Azerite Spikes at the target area, dealing {$s1=2287} damage to all enemies near its target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9502.90
  • base_dd_max:9502.90
  • base_dd_mult:1.00
 
Simple Action Stats Execute Interval
cyclotronic
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:cyclotronic
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.26sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.14sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8097 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Greater Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:298837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:cyclotronic
  • harmful:false
  • if_expr:
 
Well Fed (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:297039
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:cyclotronic
  • harmful:false
  • if_expr:
 
Guardian of Azeroth 2.0 180.35sec

Stats details: guardian_of_azeroth

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9751 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: guardian_of_azeroth

Static Values
  • id:295840
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
Spelldata
  • id:295840
  • name:Guardian of Azeroth
  • school:physical
  • tooltip:
  • description:Call upon Azeroth to summon a Guardian of Azeroth for {$300091d=30 seconds} who impales your target with spikes of Azerite every 2 sec that deal ${$295834m1*(1+$@versadmg)} Fire damage.$?a295841[ Every $303347t1 sec, the Guardian launches a volley of Azerite Spikes at its target, dealing {$295841s1=2287} Fire damage to all nearby enemies.][]$?a295843[ Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.][]
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Potion of Unbridled Fury (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:300714
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.4 55.5 42.9sec 4.8sec 93.15% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:12.41%
  • arcanic_pulsar_2:11.07%
  • arcanic_pulsar_3:11.05%
  • arcanic_pulsar_4:12.27%
  • arcanic_pulsar_5:10.63%
  • arcanic_pulsar_6:11.23%
  • arcanic_pulsar_7:10.45%
  • arcanic_pulsar_8:14.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.4sec 182.4sec 8.13% 12.25% 0.0(0.0) 2.0

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.56% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 7.8 0.0 39.9sec 39.9sec 26.44% 33.78% 0.0(0.0) 7.6

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Greater Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_greater_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:360.00

Stack Uptimes

  • greater_flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298837
  • name:Greater Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=360} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Guardian of Azeroth 2.0 59.0 180.6sec 3.5sec 19.46% 0.00% 51.0(51.0) 0.0

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_guardian_of_azeroth
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • guardian_of_azeroth_1:0.86%
  • guardian_of_azeroth_2:0.83%
  • guardian_of_azeroth_3:0.78%
  • guardian_of_azeroth_4:0.67%
  • guardian_of_azeroth_5:16.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295855
  • name:Guardian of Azeroth
  • tooltip:Haste increased by {$s1=2}%.
  • description:{$@spelldesc295843=Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.}
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Highborne Compendium of Storms 2.8 50.6 96.3sec 5.5sec 97.34% 0.00% 42.8(42.8) 1.9

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_highborne_compendium_of_storms
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Highborne Compendium of Storms

Stat Buff details

  • stat:haste_rating
  • amount:64.39

Stack Uptimes

  • highborne_compendium_of_storms_1:4.96%
  • highborne_compendium_of_storms_2:4.70%
  • highborne_compendium_of_storms_3:4.20%
  • highborne_compendium_of_storms_4:83.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:300919
  • name:Highborne Compendium of Storms
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc300913=Your spells have a chance to conjure a typhoon that travels towards enemies dealing {$300917s1=0} Nature damage and grant you $300919s~1 Haste for {$300919d=15 seconds}, up to ${$300919s*{$300919u=4}} Haste. }
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Lifeblood 108.4 0.0 150.2sec 2.7sec 98.47% 0.00% 102.3(110.5) 0.0

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_lifeblood
  • max_stacks:4
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:229.17

Stack Uptimes

  • lifeblood_1:1.16%
  • lifeblood_2:1.18%
  • lifeblood_3:1.89%
  • lifeblood_4:94.23%

Trigger Attempt Success

  • trigger_pct:92.33%

Spelldata details

  • id:295137
  • name:Lifeblood
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by ${$w1+$w2+$w3}.
  • description:{$@spelldesc295078=Every {$s4=18}-{$s1=25} sec, a Lifeblood Shard erupts from the nearby ground for {$295114d=12 seconds}.$?!s295186&a295078[ $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within ${$m2*(1+($295160m1/100))} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.][]}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 35.9 46.8 8.4sec 3.6sec 81.46% 99.61% 2.1(2.1) 0.0

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.58%
  • lunar_empowerment_2:30.10%
  • lunar_empowerment_3:14.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (mechdowels_big_mech) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_mechdowels_big_mech
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:93.00

Stack Uptimes

  • mechdowels_big_mech_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297039
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=93} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overclocking Bit Band 17.8 0.0 17.2sec 17.2sec 87.09% 0.00% 0.0(0.0) 16.9

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_overclocking_bit_band
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:160.00

Stack Uptimes

  • overclocking_bit_band_1:87.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:301886
  • name:Overclocking Bit Band
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc300126=...then you gain {$s1=0} Haste for {$s2=15} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.9 63.2sec 31.6sec 50.30% 0.00% 3.9(55.6) 0.0

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.42%
  • overwhelming_power_2:1.46%
  • overwhelming_power_3:1.50%
  • overwhelming_power_4:1.55%
  • overwhelming_power_5:1.59%
  • overwhelming_power_6:1.63%
  • overwhelming_power_7:1.68%
  • overwhelming_power_8:1.73%
  • overwhelming_power_9:1.78%
  • overwhelming_power_10:1.83%
  • overwhelming_power_11:1.88%
  • overwhelming_power_12:1.94%
  • overwhelming_power_13:2.01%
  • overwhelming_power_14:2.07%
  • overwhelming_power_15:2.13%
  • overwhelming_power_16:2.20%
  • overwhelming_power_17:2.27%
  • overwhelming_power_18:2.35%
  • overwhelming_power_19:2.42%
  • overwhelming_power_20:2.51%
  • overwhelming_power_21:2.59%
  • overwhelming_power_22:2.68%
  • overwhelming_power_23:2.78%
  • overwhelming_power_24:2.85%
  • overwhelming_power_25:1.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Unbridled Fury 2.0 0.0 190.6sec 0.0sec 39.82% 0.00% 0.0(0.0) 1.9

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_potion_of_unbridled_fury
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • potion_of_unbridled_fury_1:39.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:300714
  • name:Potion of Unbridled Fury
  • tooltip:Chance to deal an extra {$300717s1=3600} Fire damage to your current target.
  • description:Fill yourself with unbridled energy, giving your offensive spells and attacks a chance to do an additional {$300717s1=3600} Fire damage to your target. Lasts {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Prodigy's Potency 1.0 43.5 0.0sec 6.6sec 98.15% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_prodigys_potency
  • max_stacks:999
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prodigys_potency_1:1.62%
  • prodigys_potency_2:1.47%
  • prodigys_potency_3:1.49%
  • prodigys_potency_4:1.58%
  • prodigys_potency_5:1.62%
  • prodigys_potency_6:1.85%
  • prodigys_potency_7:2.04%
  • prodigys_potency_8:2.17%
  • prodigys_potency_9:2.28%
  • prodigys_potency_10:2.38%
  • prodigys_potency_11:2.43%
  • prodigys_potency_12:2.49%
  • prodigys_potency_13:2.39%
  • prodigys_potency_14:2.42%
  • prodigys_potency_15:2.51%
  • prodigys_potency_16:2.41%
  • prodigys_potency_17:2.50%
  • prodigys_potency_18:2.48%
  • prodigys_potency_19:2.47%
  • prodigys_potency_20:2.44%
  • prodigys_potency_21:2.46%
  • prodigys_potency_22:2.39%
  • prodigys_potency_23:2.44%
  • prodigys_potency_24:2.39%
  • prodigys_potency_25:2.38%
  • prodigys_potency_26:2.33%
  • prodigys_potency_27:2.38%
  • prodigys_potency_28:2.22%
  • prodigys_potency_29:2.22%
  • prodigys_potency_30:2.20%
  • prodigys_potency_31:2.24%
  • prodigys_potency_32:2.22%
  • prodigys_potency_33:2.18%
  • prodigys_potency_34:2.11%
  • prodigys_potency_35:2.10%
  • prodigys_potency_36:2.06%
  • prodigys_potency_37:1.99%
  • prodigys_potency_38:1.88%
  • prodigys_potency_39:1.85%
  • prodigys_potency_40:1.73%
  • prodigys_potency_41:1.46%
  • prodigys_potency_42:1.39%
  • prodigys_potency_43:1.23%
  • prodigys_potency_44:1.15%
  • prodigys_potency_45:1.03%
  • prodigys_potency_46:0.86%
  • prodigys_potency_47:0.85%
  • prodigys_potency_48:0.68%
  • prodigys_potency_49:0.57%
  • prodigys_potency_50:0.46%
  • prodigys_potency_51:0.40%
  • prodigys_potency_52:0.33%
  • prodigys_potency_53:0.26%
  • prodigys_potency_54:0.20%
  • prodigys_potency_55:0.19%
  • prodigys_potency_56:0.11%
  • prodigys_potency_57:0.07%
  • prodigys_potency_58:0.06%
  • prodigys_potency_59:0.06%
  • prodigys_potency_60:0.04%
  • prodigys_potency_61:0.04%
  • prodigys_potency_62:0.04%
  • prodigys_potency_63:0.05%
  • prodigys_potency_64:0.02%
  • prodigys_potency_65:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:303017
  • name:Prodigy's Potency
  • tooltip:$w1 damage and healing stored.
  • description:
  • max_stacks:999
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
Solar Empowerment 28.6 50.5 10.4sec 3.8sec 84.22% 78.25% 0.2(0.2) 0.0

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:31.31%
  • solar_empowerment_2:37.36%
  • solar_empowerment_3:15.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.4 47.7 20.1sec 4.7sec 98.17% 97.10% 17.4(17.4) 10.8

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.46%
  • starlord_2:22.35%
  • starlord_3:61.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Strife 2.1 52.1 109.7sec 5.4sec 97.72% 0.00% 39.1(39.1) 1.1

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_strife
  • max_stacks:8
  • duration:14.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:53.82

Stack Uptimes

  • strife_1:3.93%
  • strife_2:3.77%
  • strife_3:3.64%
  • strife_4:3.41%
  • strife_5:3.38%
  • strife_6:3.28%
  • strife_7:3.19%
  • strife_8:73.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:304056
  • name:Strife
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc304081=Your spells and abilities have a chance to increase your Versatility by {$s1=0} for {$304056d=8 seconds}, stacking up to {$304056u=5} times. Being the vicitim of a loss of control or movement impairing effect also grants a stack of Strife.}
  • max_stacks:5
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.2 1.1 61.1sec 46.2sec 23.18% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.18%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
unempowered_solar_wrath 21.6 13.4sec
unempowered_lunar_strike 0.3 65.6sec
wasted_streaking_star 0.1 74.2sec
arcanic_pulsar_proc 6.5 43.9sec

Resources

Resource Usage Type Count Total Average RPE APR
cyclotronic
starsurge Astral Power 63.1 2524.5 40.0 40.0 1612.4
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 98.79 790.25 (31.76%) 8.00 0.07 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.22%) 40.00 0.00 0.00%
sunfire Astral Power 17.38 52.13 (2.10%) 3.00 0.00 0.00%
shooting_stars Astral Power 47.16 188.62 (7.58%) 4.00 0.01 0.00%
moonfire Astral Power 14.01 42.03 (1.69%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.75 102.01 (4.10%) 8.00 0.00 0.00%
lunar_strike Astral Power 79.57 954.80 (38.38%) 12.00 0.08 0.01%
natures_balance Astral Power 399.02 199.51 (8.02%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.54 78.48 (3.15%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.32 8.45
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.61 0.50 48.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data cyclotronic Fight Length
Count 1192
Mean 298.89
Minimum 240.09
Maximum 359.91
Spread ( max - min ) 119.82
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data cyclotronic Damage Per Second
Count 1192
Mean 53782.20
Minimum 48724.74
Maximum 59619.24
Spread ( max - min ) 10894.50
Range [ ( max - min ) / 2 * 100% ] 10.13%
Standard Deviation 1853.2363
5th Percentile 50860.97
95th Percentile 56953.40
( 95th Percentile - 5th Percentile ) 6092.43
Mean Distribution
Standard Deviation 53.6775
95.00% Confidence Intervall ( 53677.00 - 53887.41 )
Normalized 95.00% Confidence Intervall ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4562
0.1 Scale Factor Error with Delta=300 29319
0.05 Scale Factor Error with Delta=300 117275
0.01 Scale Factor Error with Delta=300 2931874
Priority Target DPS
Sample Data cyclotronic Priority Target Damage Per Second
Count 1192
Mean 53782.20
Minimum 48724.74
Maximum 59619.24
Spread ( max - min ) 10894.50
Range [ ( max - min ) / 2 * 100% ] 10.13%
Standard Deviation 1853.2363
5th Percentile 50860.97
95th Percentile 56953.40
( 95th Percentile - 5th Percentile ) 6092.43
Mean Distribution
Standard Deviation 53.6775
95.00% Confidence Intervall ( 53677.00 - 53887.41 )
Normalized 95.00% Confidence Intervall ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4562
0.1 Scale Factor Error with Delta=300 29319
0.05 Scale Factor Error with Delta=300 117275
0.01 Scale Factor Error with Delta=300 2931874
DPS(e)
Sample Data cyclotronic Damage Per Second (Effective)
Count 1192
Mean 53782.20
Minimum 48724.74
Maximum 59619.24
Spread ( max - min ) 10894.50
Range [ ( max - min ) / 2 * 100% ] 10.13%
Damage
Sample Data cyclotronic Damage
Count 1192
Mean 15264391.75
Minimum 11943862.55
Maximum 18929081.48
Spread ( max - min ) 6985218.94
Range [ ( max - min ) / 2 * 100% ] 22.88%
DTPS
Sample Data cyclotronic Damage Taken Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data cyclotronic Healing Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data cyclotronic Healing Per Second (Effective)
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data cyclotronic Heal
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data cyclotronic Healing Taken Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data cyclotronic Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data cyclotronicTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data cyclotronic Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
Azerite variables
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
Starfall v Starsurge target cutoff
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6
F 2.00 berserking,if=buff.ca_inc.up
0.00 use_item,name=azsharas_font_of_power,if=equipped.169314&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
CDs
G 2.00 guardian_of_azeroth,if=(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
0.00 use_item,name=tidestorm_codex,if=equipped.165576
H 2.95 use_item,name=pocketsized_computation_device,if=equipped.167555&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
0.00 use_item,name=shiver_venom_relic,if=equipped.168905&cooldown.ca_inc.remains>30&!buff.ca_inc.up
0.00 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(!talent.stellar_flare.enabled|dot.stellar_flare.remains>10)&!buff.ca_inc.up&(astral_power<25|cooldown.ca_inc.remains>30)
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 focused_azerite_beam
0.00 thorns
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(buff.memory_of_lucid_dreams.up|ap_check)&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)
I 2.00 celestial_alignment,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 3.63 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
Spenders
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 63.11 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.19 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.65 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.82 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
DoTs
O 11.37 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.75 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
Generators
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 79.95 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 98.02 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.37 sunfire
Fallthru for movement

Sample Sequence

0123456789ACDKONPGHIFKRKRQRQKRNRQORQJKRKPRQKRQRKQQQRRRNRKRQJKRKRQKOQQPKQQRQNRRRRJKKQROQQKRQKNPRQQRRKRKRQKMQQKNRQRRPQRRKKQQRKQNORRKQRRQRPKQKRQKRQHNOKQQRRRRKQKNPQQKROQKRQQRQKNQRKQPRRKRQKRQMRRNKQRKQGRRRIEFKPKRQKORQNRQRKRQKRQRQKRQKRQRKLPOQQQKRKRQQRKQRRNRKQRROPRKQRKQRHNRKRQKRQMQKPQQKQRQKQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask cyclotronic 58.0/100: 58% astral_power
Pre precombat 1 food cyclotronic 58.0/100: 58% astral_power
Pre precombat 2 augmentation cyclotronic 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power potion_of_unbridled_fury
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power potion_of_unbridled_fury
0:01.211 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, potion_of_unbridled_fury
0:02.116 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms, potion_of_unbridled_fury
0:02.997 default P stellar_flare Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(2), potion_of_unbridled_fury
0:03.871 default G guardian_of_azeroth Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(2), potion_of_unbridled_fury
0:04.745 default H use_item_pocketsized_computation_device Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(2), strife, potion_of_unbridled_fury
0:07.302 default I celestial_alignment Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, guardian_of_azeroth(3), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(2), strife, potion_of_unbridled_fury
0:08.055 default F berserking Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, guardian_of_azeroth(3), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(3), strife(2), potion_of_unbridled_fury
0:08.055 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, berserking, guardian_of_azeroth(3), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(3), strife(2), potion_of_unbridled_fury
0:08.810 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency, strife(2), potion_of_unbridled_fury
0:09.565 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency, strife(2), potion_of_unbridled_fury
0:10.321 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(2), strife(2), potion_of_unbridled_fury
0:11.077 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(2), strife(2), potion_of_unbridled_fury
0:11.831 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:12.584 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:13.338 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:14.092 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:14.846 default N sunfire Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, lifeblood(2), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(2), strife(4), potion_of_unbridled_fury
0:15.602 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(2), strife(4), potion_of_unbridled_fury
0:16.356 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), highborne_compendium_of_storms(3), prodigys_potency(2), strife(4), potion_of_unbridled_fury
0:17.120 default O moonfire Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(4), potion_of_unbridled_fury
0:17.877 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(4), potion_of_unbridled_fury
0:18.631 default Q lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(4), potion_of_unbridled_fury
0:19.386 default J cancel_buff Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(4), potion_of_unbridled_fury
0:19.386 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(4), potion_of_unbridled_fury
0:20.140 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(5), potion_of_unbridled_fury
0:20.894 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(5), potion_of_unbridled_fury
0:21.649 default P stellar_flare Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(5), potion_of_unbridled_fury
0:22.404 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(5), potion_of_unbridled_fury
0:23.159 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(5), potion_of_unbridled_fury
0:24.003 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(5), potion_of_unbridled_fury
0:24.758 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(5), potion_of_unbridled_fury
0:25.513 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(5), potion_of_unbridled_fury
0:26.334 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(5), potion_of_unbridled_fury
0:27.089 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(5), potion_of_unbridled_fury
0:27.842 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), strife(5), potion_of_unbridled_fury
0:28.786 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), strife(5), potion_of_unbridled_fury
0:29.729 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), strife(5), potion_of_unbridled_fury
0:30.671 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), strife(5), potion_of_unbridled_fury
0:31.424 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), strife(5), potion_of_unbridled_fury
0:32.178 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(24), strife(6), potion_of_unbridled_fury
0:32.933 default N sunfire Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(24), strife(6), potion_of_unbridled_fury
0:33.686 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(23), strife(6), potion_of_unbridled_fury
0:34.441 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(22), strife(6), potion_of_unbridled_fury
0:35.200 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(21), strife(6), potion_of_unbridled_fury
0:35.955 default Q lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power bloodlust, lifeblood(4), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(21), strife(6), potion_of_unbridled_fury
0:36.798 default J cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, lifeblood(4), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(20), strife(6), potion_of_unbridled_fury
0:36.798 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, lifeblood(4), celestial_alignment, lunar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(20), strife(6), potion_of_unbridled_fury
0:37.554 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(19), strife(6), potion_of_unbridled_fury
0:38.308 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(18), strife(6), potion_of_unbridled_fury
0:39.062 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(17), strife(6), potion_of_unbridled_fury
0:39.816 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(17), strife(6), potion_of_unbridled_fury
0:40.693 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(16), strife(6), potion_of_unbridled_fury
0:41.448 default O moonfire Fluffy_Pillow 4.5/100: 5% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(15), strife(6), potion_of_unbridled_fury
0:42.452 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(14), strife(6), potion_of_unbridled_fury
0:43.735 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(13), strife(6), potion_of_unbridled_fury
0:45.024 default P stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(11), strife(7), potion_of_unbridled_fury
0:46.044 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(10), strife(7), potion_of_unbridled_fury
0:47.067 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(9), strife(7), potion_of_unbridled_fury
0:48.375 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(8), strife(8), potion_of_unbridled_fury
0:49.709 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(7), strife(8), potion_of_unbridled_fury
0:50.602 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(6), strife(8), potion_of_unbridled_fury
0:51.946 default N sunfire Fluffy_Pillow 54.5/100: 55% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(8), overwhelming_power(5), strife(8), potion_of_unbridled_fury
0:53.003 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), overwhelming_power(3), strife(8), potion_of_unbridled_fury
0:53.893 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), overwhelming_power(3), strife(8), potion_of_unbridled_fury
0:54.785 default R solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), overwhelming_power(2), strife(8), potion_of_unbridled_fury
0:55.678 default R solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), overwhelming_power, strife(8), potion_of_unbridled_fury
0:56.731 default J cancel_buff Fluffy_Pillow 96.5/100: 97% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(8), potion_of_unbridled_fury
0:56.731 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(8), potion_of_unbridled_fury
0:57.885 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(8), potion_of_unbridled_fury
0:59.004 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(8)
1:00.390 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(8)
1:01.316 default O moonfire Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(8)
1:02.403 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(8)
1:03.790 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(8)
1:05.177 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), strife(8)
1:06.266 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), strife(8)
1:07.166 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), strife(8)
1:08.513 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), strife(8)
1:09.573 default N sunfire Fluffy_Pillow 16.0/100: 16% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), strife(8)
1:10.631 default P stellar_flare Fluffy_Pillow 20.0/100: 20% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), strife(8)
1:11.690 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), strife(8)
1:12.589 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), strife(8)
1:13.938 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), strife(8)
1:15.285 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:16.184 default R solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:17.084 default K starsurge Fluffy_Pillow 84.0/100: 84% astral_power lifeblood(4), arcanic_pulsar(8), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:18.237 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:19.067 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:20.042 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:20.847 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:22.054 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:23.001 default M moonfire Fluffy_Pillow 12.0/100: 12% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:23.939 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(12), strife(8)
1:25.311 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(12), strife(8)
1:26.658 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(12), strife(8)
1:27.717 default N sunfire Fluffy_Pillow 2.0/100: 2% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(12), strife(8)
1:28.776 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(12), strife(8)
1:29.673 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(12)
1:31.020 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13)
1:31.920 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13)
1:32.820 default P stellar_flare Fluffy_Pillow 44.5/100: 45% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13)
1:33.878 default Q lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13)
1:35.225 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13)
1:36.284 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), strife
1:37.343 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power lifeblood(4), arcanic_pulsar(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), strife
1:38.498 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), strife
1:39.617 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, prodigys_potency(13), strife
1:41.042 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), highborne_compendium_of_storms, prodigys_potency(13), strife
1:42.486 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(2), starlord(2), highborne_compendium_of_storms, prodigys_potency(13), strife
1:43.450 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(13), strife
1:44.562 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(13), strife
1:45.937 default N sunfire Fluffy_Pillow 17.5/100: 18% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(14), strife(2)
1:47.019 default O moonfire Fluffy_Pillow 21.0/100: 21% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(15), strife(2)
1:48.100 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(15), strife(2)
1:49.020 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(15), strife(3)
1:49.938 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power lifeblood(4), arcanic_pulsar(6), starlord(3), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(15), strife(3)
1:51.019 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(15), strife(3)
1:52.398 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms, torrent_of_elements, prodigys_potency(15), strife(4)
1:53.319 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power lifeblood(4), arcanic_pulsar(7), starlord(3), overclocking_bit_band, highborne_compendium_of_storms, torrent_of_elements, prodigys_potency(15), strife(4)
1:54.401 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms, torrent_of_elements, prodigys_potency(15), strife(4)
1:55.780 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), arcanic_pulsar(7), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), torrent_of_elements, prodigys_potency(15), overwhelming_power(24), strife(5)
1:56.769 default P stellar_flare Fluffy_Pillow 58.5/100: 59% astral_power lifeblood(4), arcanic_pulsar(7), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), torrent_of_elements, prodigys_potency(15), overwhelming_power(23), strife(5)
1:57.755 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power lifeblood(4), arcanic_pulsar(7), overclocking_bit_band, highborne_compendium_of_storms(3), torrent_of_elements, prodigys_potency(15), overwhelming_power(22), strife(5)
1:58.835 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, highborne_compendium_of_storms(3), torrent_of_elements, prodigys_potency(15), overwhelming_power(21), strife(5)
2:00.195 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord, highborne_compendium_of_storms(3), torrent_of_elements, prodigys_potency(15), overwhelming_power(19), strife(5)
2:01.270 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), highborne_compendium_of_storms(3), torrent_of_elements, prodigys_potency(15), overwhelming_power(18), strife(5)
2:02.044 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(15), overwhelming_power(17), strife(5)
2:03.182 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(15), overwhelming_power(16), strife(6)
2:04.079 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), overwhelming_power(15), strife(6)
2:04.836 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), overwhelming_power(15), strife(6)
2:05.949 default H use_item_pocketsized_computation_device Fluffy_Pillow 32.5/100: 33% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), overwhelming_power(14), strife(6)
2:08.546 default N sunfire Fluffy_Pillow 34.5/100: 35% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(16), overwhelming_power(11), strife(7)
2:09.565 default O moonfire Fluffy_Pillow 38.0/100: 38% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(16), overwhelming_power(10), strife(7)
2:10.586 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(16), overwhelming_power(9), strife(7)
2:11.612 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(16), overwhelming_power(8), strife(7)
2:12.924 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(16), overwhelming_power(7), strife(7)
2:14.241 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power lifeblood(3), arcanic_pulsar(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(16), overwhelming_power(5), strife(7)
2:15.125 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power lifeblood(3), arcanic_pulsar(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(16), overwhelming_power(4), strife(7)
2:16.011 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power lifeblood(4), arcanic_pulsar(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(16), overwhelming_power(3), strife(7)
2:17.058 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power lifeblood(4), arcanic_pulsar(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(16), overwhelming_power(2), strife(7)
2:18.130 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, highborne_compendium_of_storms(4), prodigys_potency(16), overwhelming_power, strife(7)
2:19.301 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, highborne_compendium_of_storms(4), prodigys_potency(16), strife(7)
2:20.754 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(7)
2:21.873 default N sunfire Fluffy_Pillow 13.5/100: 14% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17)
2:22.961 default P stellar_flare Fluffy_Pillow 17.0/100: 17% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife
2:24.051 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife
2:25.438 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife
2:26.824 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife(2)
2:27.914 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife(2)
2:28.814 default O moonfire Fluffy_Pillow 25.0/100: 25% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), strife(2)
2:29.873 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), strife(3)
2:31.221 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), strife(3)
2:32.281 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), strife(3)
2:33.181 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), strife(4)
2:34.529 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife(4)
2:35.876 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(20), strife(4)
2:36.792 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(20), strife(4)
2:38.166 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment, highborne_compendium_of_storms(4), prodigys_potency(20), strife(4)
2:39.340 default N sunfire Fluffy_Pillow 19.0/100: 19% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife(4)
2:40.459 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife(4)
2:41.885 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife(4)
2:42.837 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife(4)
2:43.957 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife(4)
2:45.344 default P stellar_flare Fluffy_Pillow 22.0/100: 22% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife(4)
2:46.433 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife(5)
2:47.360 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife(5)
2:48.284 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power lifeblood(4), arcanic_pulsar(8), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife(5)
2:49.373 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife(6)
2:50.156 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife(6)
2:51.330 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power lifeblood(4), celestial_alignment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(6)
2:52.251 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(6)
2:53.033 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(6)
2:54.205 default M moonfire Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(6)
2:55.125 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power lifeblood(4), arcanic_pulsar, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(6)
2:56.183 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power lifeblood(4), arcanic_pulsar, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(6)
2:57.242 default N sunfire Fluffy_Pillow 53.0/100: 53% astral_power lifeblood(4), arcanic_pulsar, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(6)
2:58.301 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power lifeblood(4), arcanic_pulsar, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(6)
2:59.455 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(6)
3:00.882 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(6)
3:01.831 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), overwhelming_power(25), strife(6)
3:02.861 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), overwhelming_power(25)
3:04.135 default G guardian_of_azeroth Fluffy_Pillow 20.5/100: 21% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), overwhelming_power(25), strife
3:05.137 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), overwhelming_power(24), strife
3:05.991 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power lifeblood(4), guardian_of_azeroth, arcanic_pulsar(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), overwhelming_power(25), strife
3:06.825 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power lifeblood(4), guardian_of_azeroth(2), arcanic_pulsar(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), overwhelming_power(24), strife(2)
3:07.792 default I celestial_alignment Fluffy_Pillow 47.0/100: 47% astral_power lifeblood(4), guardian_of_azeroth(2), arcanic_pulsar(3), celestial_alignment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), overwhelming_power(23), strife(2)
3:08.635 default E potion Fluffy_Pillow 87.5/100: 88% astral_power lifeblood(4), guardian_of_azeroth(3), arcanic_pulsar(3), celestial_alignment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), overwhelming_power(22), strife(2)
3:08.635 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power lifeblood(4), guardian_of_azeroth(3), arcanic_pulsar(3), celestial_alignment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), overwhelming_power(22), strife(2), potion_of_unbridled_fury
3:08.635 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power berserking, lifeblood(4), guardian_of_azeroth(3), arcanic_pulsar(3), celestial_alignment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), overwhelming_power(22), strife(2), potion_of_unbridled_fury
3:09.389 default P stellar_flare Fluffy_Pillow 48.0/100: 48% astral_power berserking, lifeblood(4), guardian_of_azeroth(4), arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(22), overwhelming_power(21), strife(2), potion_of_unbridled_fury
3:10.143 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(22), overwhelming_power(20), strife(3), potion_of_unbridled_fury
3:10.899 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(22), overwhelming_power(20), strife(3), potion_of_unbridled_fury
3:11.653 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), overwhelming_power(19), strife(3), potion_of_unbridled_fury
3:12.563 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(18), strife(3), potion_of_unbridled_fury
3:13.316 default O moonfire Fluffy_Pillow 6.5/100: 7% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(17), strife(3), potion_of_unbridled_fury
3:14.069 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(16), strife(3), potion_of_unbridled_fury
3:14.822 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(16), strife(3), potion_of_unbridled_fury
3:15.740 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(15), strife(3), potion_of_unbridled_fury
3:16.495 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(14), strife(3), potion_of_unbridled_fury
3:17.249 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(13), strife(3), potion_of_unbridled_fury
3:18.178 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(12), strife(3), potion_of_unbridled_fury
3:18.931 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(12), strife(3), potion_of_unbridled_fury
3:19.728 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(11), strife(3), potion_of_unbridled_fury
3:20.483 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(10), strife(3), potion_of_unbridled_fury
3:21.474 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(9), strife(3), potion_of_unbridled_fury
3:22.333 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(8), strife(4), potion_of_unbridled_fury
3:23.087 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(7), strife(4), potion_of_unbridled_fury
3:24.157 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(25), overwhelming_power(6), strife(4), potion_of_unbridled_fury
3:25.000 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), overwhelming_power(5), strife(4), potion_of_unbridled_fury
3:26.078 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), overwhelming_power(4), strife(5), potion_of_unbridled_fury
3:26.928 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(26), overwhelming_power(4), strife(5), potion_of_unbridled_fury
3:27.683 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(26), overwhelming_power(3), strife(5), potion_of_unbridled_fury
3:28.758 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(26), overwhelming_power(2), strife(6), potion_of_unbridled_fury
3:29.604 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), overwhelming_power, strife(6), potion_of_unbridled_fury
3:30.358 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(6), potion_of_unbridled_fury
3:31.424 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(7), potion_of_unbridled_fury
3:32.177 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(7), potion_of_unbridled_fury
3:33.013 default L sunfire Fluffy_Pillow 6.0/100: 6% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(7), potion_of_unbridled_fury
3:33.849 default P stellar_flare Fluffy_Pillow 13.5/100: 14% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(7), potion_of_unbridled_fury
3:34.813 default O moonfire Fluffy_Pillow 22.0/100: 22% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(7), potion_of_unbridled_fury
3:35.873 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(7), potion_of_unbridled_fury
3:37.218 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:38.567 default Q lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), overwhelming_power(24), strife(8), potion_of_unbridled_fury
3:39.812 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), overwhelming_power(23), strife(8), potion_of_unbridled_fury
3:40.879 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), overwhelming_power(22), strife(8), potion_of_unbridled_fury
3:41.763 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), overwhelming_power(21), strife(8), potion_of_unbridled_fury
3:42.806 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), overwhelming_power(20), strife(8), potion_of_unbridled_fury
3:43.670 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), overwhelming_power(19), strife(8), potion_of_unbridled_fury
3:44.968 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), overwhelming_power(18), strife(8), potion_of_unbridled_fury
3:46.271 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(16), strife(8), potion_of_unbridled_fury
3:47.147 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(24), strife(8), potion_of_unbridled_fury
3:48.150 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(23), strife(8), potion_of_unbridled_fury
3:49.398 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(22), strife(8), potion_of_unbridled_fury
3:50.234 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(21), strife(8), potion_of_unbridled_fury
3:51.072 default N sunfire Fluffy_Pillow 36.0/100: 36% astral_power lifeblood(4), arcanic_pulsar(5), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(20), strife(8), potion_of_unbridled_fury
3:52.061 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), arcanic_pulsar(5), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(19), strife(8), potion_of_unbridled_fury
3:53.055 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power lifeblood(4), arcanic_pulsar(5), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(18), strife(8), potion_of_unbridled_fury
3:54.053 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(17), strife(8), potion_of_unbridled_fury
3:55.326 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power lifeblood(3), arcanic_pulsar(6), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(16), strife(8), potion_of_unbridled_fury
3:56.179 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power lifeblood(3), arcanic_pulsar(6), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(15), strife(8), potion_of_unbridled_fury
3:57.184 default O moonfire Fluffy_Pillow 39.0/100: 39% astral_power lifeblood(4), arcanic_pulsar(6), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(14), strife(8), potion_of_unbridled_fury
3:58.193 default P stellar_flare Fluffy_Pillow 46.5/100: 47% astral_power lifeblood(4), arcanic_pulsar(6), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(13), strife(8), potion_of_unbridled_fury
3:59.208 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power lifeblood(4), arcanic_pulsar(6), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), overwhelming_power(12), strife(8), potion_of_unbridled_fury
4:00.223 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power lifeblood(4), arcanic_pulsar(6), highborne_compendium_of_storms(4), prodigys_potency(30), overwhelming_power(11), strife(8), potion_of_unbridled_fury
4:01.352 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, highborne_compendium_of_storms(4), prodigys_potency(30), overwhelming_power(10), strife(8), potion_of_unbridled_fury
4:02.754 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), overwhelming_power(9), strife(8), potion_of_unbridled_fury
4:03.675 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(30), overwhelming_power(8), strife(8), potion_of_unbridled_fury
4:04.763 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(30), overwhelming_power(7), strife(8), potion_of_unbridled_fury
4:06.116 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(30), overwhelming_power(5), strife(8), potion_of_unbridled_fury
4:07.026 default H use_item_pocketsized_computation_device Fluffy_Pillow 28.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(30), overwhelming_power(4), strife(8), potion_of_unbridled_fury
4:10.055 default N sunfire Fluffy_Pillow 30.5/100: 31% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), overwhelming_power, strife(8)
4:11.139 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(32), strife(8)
4:12.063 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power lifeblood(4), arcanic_pulsar(8), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(32), strife(8)
4:13.150 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(32), strife(8)
4:13.933 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(32), strife(8)
4:15.104 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(32), strife(8)
4:16.023 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(32), strife(8)
4:16.806 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(32), strife(8)
4:17.977 default M moonfire Fluffy_Pillow 26.5/100: 27% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(32), strife(8)
4:18.915 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8)
4:20.262 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8)
4:21.416 default P stellar_flare Fluffy_Pillow 4.0/100: 4% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8)
4:22.536 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8)
4:23.963 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8)
4:25.389 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8)
4:26.510 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8)
4:27.897 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(34), strife(8)
4:28.823 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(34), strife(8)
4:30.208 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(34), strife(8)
4:31.297 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(34), strife(8)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16715 15195 12905
Intellect 1467 -3 12229 10676 8704 (5789)
Spirit 0 0 0 0 0
Health 334300 303900 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 12229 10676 0
Crit 24.60% 23.31% 1318
Haste 24.38% 24.38% 1658
Damage / Heal Versatility 3.81% 3.81% 324
ManaReg per Second 2396 640 0
Attack Power 12718 11103 0
Mastery 37.17% 37.17% 1162
Armor 2828 2828 2828
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 433.00
Local Head Shroud of Unmooring Whispers
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
azerite powers: { Streaking Stars, Arcanic Pulsar, Overwhelming Power }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Shoulderpads of Frothing Rage
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
azerite powers: { Streaking Stars, Loyal to the End, Heed My Call }
Local Chest Tunic of the Sycophant
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
azerite powers: { Streaking Stars, Undulating Tides, Gutripper }
Local Waist Vim's Scalecrusher Clasp
ilevel: 425, stats: { 233 Armor, +358 AgiInt, +637 Sta, +102 Crit, +111 Haste }, gems: { +50 Haste }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Akana's Reefstrider Footwraps
ilevel: 425, stats: { 285 Armor, +358 AgiInt, +637 Sta, +102 Mastery, +111 Haste }, gems: { +50 Haste }
Local Wrists Ori's Tidal Wristwraps
ilevel: 425, stats: { 181 Armor, +268 AgiInt, +478 Sta, +87 Vers, +73 Haste }, gems: { +50 Haste }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Overclocking Bit Band
ilevel: 415, stats: { +430 Sta, +388 Haste, +97 Mastery }, enchant: { +60 Crit }
Local Finger2 Logic Loop of Recursion
ilevel: 415, stats: { +430 Sta, +361 Crit, +124 Haste }, enchant: { +60 Crit }
Local Trinket1 Pocket-Sized Computation Device
ilevel: 420
Local Trinket2 Highborne Compendium of Storms
ilevel: 400, stats: { +359 Int }
Local Back Shirakess Drape
ilevel: 425, stats: { 122 Armor, +268 StrAgiInt, +478 Sta, +83 Haste, +77 Mastery }, gems: { +50 Haste }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="cyclotronic"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
professions=engineering=100/jewelcrafting=100
talents=1000231
azerite_essences=14:3:1/32:3:0/4:3:0

# Default consumables
potion=unbridled_fury
flask=greater_flask_of_endless_fathoms
food=mechdowels_big_mech
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Azerite variables
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
# Starfall v Starsurge target cutoff
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6
actions+=/berserking,if=buff.ca_inc.up
# CDs
actions+=/use_item,name=azsharas_font_of_power,if=equipped.169314&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/guardian_of_azeroth,if=(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_item,name=pocketsized_computation_device,if=equipped.167555&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/use_item,name=shiver_venom_relic,if=equipped.168905&cooldown.ca_inc.remains>30&!buff.ca_inc.up
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(!talent.stellar_flare.enabled|dot.stellar_flare.remains>10)&!buff.ca_inc.up&(astral_power<25|cooldown.ca_inc.remains>30)
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/focused_azerite_beam
actions+=/thorns
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(buff.memory_of_lucid_dreams.up|ap_check)&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)
actions+=/celestial_alignment,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
# Spenders
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
# DoTs
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
# Generators
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
# Fallthru for movement
actions+=/sunfire

head=shroud_of_unmooring_whispers,id=168349,ilevel=450,azerite_powers=122/200/30
neck=heart_of_azeroth,id=158075,ilevel=463,azerite_level=65
shoulders=shoulderpads_of_frothing_rage,id=168348,ilevel=450,azerite_powers=122/576/22
back=shirakess_drape,id=169486,ilevel=425,gems=50haste
chest=tunic_of_the_sycophant,id=168350,ilevel=450,azerite_powers=122/575/31
wrists=oris_tidal_wristwraps,id=170305,ilevel=425,gems=50haste
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=vims_scalecrusher_clasp,id=170368,ilevel=425,gems=50haste
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=akanas_reefstrider_footwraps,id=170141,ilevel=425,gems=50haste
finger1=overclocking_bit_band,id=169159,ilevel=415,enchant=60crit
finger2=logic_loop_of_recursion,id=169158,ilevel=415,enchant=60crit
trinket1=pocketsized_computation_device,id=167555,ilevel=420,gem_id=167672/168742
trinket2=highborne_compendium_of_storms,id=169328,ilevel=400
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=433.20
# gear_stamina=12905
# gear_intellect=8704
# gear_crit_rating=1143
# gear_haste_rating=1658
# gear_mastery_rating=805
# gear_versatility_rating=266
# gear_armor=2828

fuse : 53886 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
53886.5 53886.5 100.9 / 0.187% 6711.4 / 12.5% 5800.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.8 8.7 Astral Power 0.00% 62.6 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator
Professions
  • engineering: 100
  • jewelcrafting: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
fuse 53886
Azerite Spike 1048 1.9% 18.4 15.96sec 17031 0 Direct 18.3 13808 28470 17048 22.1%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.36 18.34 0.00 0.00 0.0000 0.0000 312712.40 312712.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.28 77.88% 13808.33 12665 15347 13807.66 13218 14586 197239 197239 0.00
crit 4.06 22.12% 28469.96 26090 31616 28062.43 0 31616 115473 115473 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295835
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:90.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295835
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:{$@spelldesc295834=Your spells and abilities have a high chance to impale your target with a spike of Azerite, causing ${$m1*(1+$@versadmg)} Fire damage.$?a295837[ When an Azerite spike deals damage, all damage you deal against that target is increased by {$295838s1=5}% for {$295838d=6 seconds}.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11696.33
  • base_dd_max:11696.33
  • base_dd_mult:1.00
 
Conch Strike 384 0.7% 13.7 21.12sec 8347 0 Direct 13.6 6842 14098 8429 21.9%  

Stats details: conch_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.73 13.59 0.00 0.00 0.0000 0.0000 114577.66 163682.37 30.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.62 78.12% 6841.97 6415 7067 6842.85 6637 7031 72650 103786 30.00
crit 2.97 21.88% 14097.73 13215 14558 13575.74 0 14558 41927 59896 28.89
 
 

Action details: conch_strike

Static Values
  • id:304698
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:304698
  • name:Conch Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc304697=While in Nazjatar or the Eternal Palace, your spells and abilities have a chance to deal Physical damage and increased threat to enemies in a small area around the target. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8462.82
  • base_dd_max:8462.82
  • base_dd_mult:1.00
 
Frost Blast 586 1.1% 13.5 21.07sec 12960 0 Direct 13.5 10508 21634 12963 22.0%  

Stats details: frost_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.51 13.51 0.00 0.00 0.0000 0.0000 175026.74 175026.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.53 77.97% 10508.44 9623 11661 10509.57 9985 11265 110644 110644 0.00
crit 2.98 22.03% 21634.11 19824 24023 20759.83 0 24023 64383 64383 0.00
 
 

Action details: frost_blast

Static Values
  • id:304645
  • school:frost
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:304645
  • name:Frost Blast
  • school:frost
  • tooltip:Slowed.
  • description:{$@spelldesc304640=While in Nazjatar or the Eternal Palace, your spells and abilities have a chance to deal {$304645s1=0} Frost damage to your target, slowing them for {$304645d=6 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8887.35
  • base_dd_max:8887.35
  • base_dd_mult:1.00
 
Gutripper 540 1.0% 39.3 7.55sec 4103 0 Direct 39.3 3308 6816 4103 22.7%  

Stats details: gutripper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.26 39.26 0.00 0.00 0.0000 0.0000 161070.91 230101.30 30.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.36 77.35% 3308.20 3100 3415 3309.26 3204 3373 100454 143506 30.00
crit 8.89 22.65% 6815.89 6386 7035 6812.69 0 7035 60617 86596 29.97
 
 

Action details: gutripper

Static Values
  • id:269031
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:269031
  • name:Gutripper
  • school:physical
  • tooltip:
  • description:{$@spelldesc266937=Your damaging abilities have a chance to deal {$s1=1112} Physical damage to the target. Gutripper occurs much more often against targets below {$s2=30}% health. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4090.00
  • base_dd_max:4090.00
  • base_dd_mult:1.00
 
Heed My Call 357 (510) 0.7% (0.9%) 9.0 30.30sec 16951 0 Direct 9.0 9587 19715 11873 22.6%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.99 8.99 0.00 0.00 0.0000 0.0000 106797.16 106797.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.96 77.42% 9587.21 8778 10637 9577.64 0 10423 66761 66761 0.00
crit 2.03 22.58% 19714.52 18082 21912 17585.15 0 21912 40037 40037 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 153 0.3% 9.0 30.30sec 5078 0 Direct 9.0 4108 8456 5077 22.3%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.99 8.99 0.00 0.00 0.0000 0.0000 45679.09 45679.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.99 77.67% 4107.82 3762 4559 4108.68 3843 4559 28698 28698 0.00
crit 2.01 22.33% 8455.96 7749 9391 7345.99 0 9391 16981 16981 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6380 11.9% 83.6 3.48sec 22788 19055 Direct 83.6 18471 38081 22789 22.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.61 83.61 0.00 0.00 1.1959 0.0000 1905368.63 1905368.63 0.00 19055.40 19055.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.21 77.98% 18470.59 12253 22778 18475.99 17930 19281 1204403 1204403 0.00
crit 18.41 22.02% 38080.53 22476 46923 38091.44 35960 40874 700965 700965 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3090 5.7% 14.2 21.23sec 65043 68728 Direct 14.2 3072 6318 3792 22.2%  
Periodic 244.2 2878 5931 3555 22.2% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.18 14.18 244.24 244.24 0.9464 1.2155 922058.68 922058.68 0.00 2971.70 68728.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.03 77.83% 3071.54 2498 3768 3071.51 2869 3320 33891 33891 0.00
crit 3.14 22.17% 6318.25 5146 7762 6133.66 0 7762 19853 19853 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 190.1 77.81% 2877.85 8 3508 2878.75 2801 2983 546937 546937 0.00
crit 54.2 22.19% 5930.61 134 7227 5932.42 5675 6266 321378 321378 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Potion of Unbridled Fury 1459 2.7% 81.5 3.01sec 5284 0 Direct 81.5 4272 8802 5284 22.3%  

Stats details: potion_of_unbridled_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.50 81.50 0.00 0.00 0.0000 0.0000 430661.73 430661.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.30 77.67% 4272.15 3898 4724 4272.14 4133 4496 270443 270443 0.00
crit 18.20 22.33% 8802.04 8030 9731 8802.68 8404 9456 160219 160219 0.00
 
 

Action details: potion_of_unbridled_fury

Static Values
  • id:300717
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:300717
  • name:Potion of Unbridled Fury
  • school:fire
  • tooltip:
  • description:Deal {$s1=3600} Fire damage to your current target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3600.00
  • base_dd_max:3600.00
  • base_dd_mult:1.00
 
Shooting Stars 1136 2.1% 49.1 5.96sec 6909 0 Direct 49.1 5596 11523 6909 22.2%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.08 49.08 0.00 0.00 0.0000 0.0000 339074.25 339074.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.20 77.84% 5595.64 4522 6820 5597.21 5280 5923 213765 213765 0.00
crit 10.87 22.16% 11522.77 9314 14049 11525.84 10477 12956 125309 125309 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 4042 (5828) 7.5% (10.8%) 103.9 2.83sec 16745 19610 Direct 104.4 9342 19245 11560 22.4%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.92 104.40 0.00 0.00 0.8539 0.0000 1206901.32 1206901.32 0.00 19610.09 19610.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.01 77.59% 9341.55 7536 11367 9345.26 9024 9744 756732 756732 0.00
crit 23.39 22.41% 19244.99 15524 23415 19250.93 17992 20586 450169 450169 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (_empowered) 1786 3.3% 80.4 3.62sec 6629 0 Direct 80.4 6630 0 6630 0.0%  

Stats details: solar_wrath_empowered

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.43 80.43 0.00 0.00 0.0000 0.0000 533219.57 533219.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.43 100.00% 6629.69 4528 13347 6630.53 5822 7542 533220 533220 0.00
 
 

Action details: solar_wrath_empowered

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5477.75
  • base_dd_max:5477.75
  • base_dd_mult:1.00
 
Starsurge 14438 26.8% 65.9 4.56sec 65392 67336 Direct 65.7 53151 109534 65572 22.1%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.91 65.71 0.00 0.00 0.9711 0.0000 4309909.02 4309909.02 0.00 67336.02 67336.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.22 77.94% 53151.27 43153 64684 53166.38 51192 55554 2722414 2722414 0.00
crit 14.49 22.06% 109534.49 88895 133248 109575.87 102599 118745 1587495 1587495 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 2012 3.7% 12.8 23.56sec 47009 49990 Direct 12.8 2655 5462 3277 22.1%  
Periodic 242.2 1870 3854 2307 22.0% 98.5%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.77 12.77 242.15 242.15 0.9404 1.2154 600426.84 600426.84 0.00 1960.10 49989.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.95 77.89% 2655.07 2154 3248 2654.84 2462 2870 26410 26410 0.00
crit 2.82 22.11% 5461.61 4436 6692 5181.25 0 6692 15426 15426 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 188.8 77.97% 1869.80 4 2274 1870.43 1819 1946 353046 353046 0.00
crit 53.3 22.03% 3853.61 230 4684 3855.26 3713 4053 205545 205545 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Storm of the Eternal 528 1.0% 6.0 120.00sec 26002 0 Direct 6.0 21058 43453 26109 22.5%  

Stats details: storm_of_the_eternal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 5.98 0.00 0.00 0.0000 0.0000 156011.08 156011.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.63 77.49% 21057.71 19370 23473 21062.37 19370 23473 97539 97539 0.00
crit 1.35 22.51% 43453.41 39903 48353 34481.83 0 48353 58473 58473 0.00
 
 

Action details: storm_of_the_eternal

Static Values
  • id:303725
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303725
  • name:Storm of the Eternal
  • school:arcane
  • tooltip:
  • description:{$@spelldesc303733=Storm of the Eternal rises for {$303723d=10 seconds} every {$303722d=120 seconds}, dealing ${{$s1=0}*(1+$@versadmg)} Arcane damage {$303724u=3} times to a random enemy within $303725A1 yds. All Storm of the Eternal effects occur simultaneously.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17887.88
  • base_dd_max:17887.88
  • base_dd_mult:1.00
 
Storms Reckoning 930 1.7% 55.1 5.34sec 5040 0 Direct 54.7 4102 8455 5072 22.3%  

Stats details: storms_reckoning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.09 54.74 0.00 0.00 0.0000 0.0000 277668.02 277668.02 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.54 77.71% 4102.21 3761 4557 4102.78 3975 4255 174517 174517 0.00
crit 12.20 22.29% 8454.90 7747 9388 8456.64 8133 9056 103151 103151 0.00
 
 

Action details: storms_reckoning

Static Values
  • id:300917
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:15.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:300917
  • name:Storms Reckoning
  • school:nature
  • tooltip:
  • description:{$@spelldesc300913=Your spells have a chance to conjure a typhoon that travels towards enemies dealing {$300917s1=0} Nature damage and grant you $300919s~1 Haste for {$300919d=15 seconds}, up to ${$300919s*{$300919u=4}} Haste. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3473.28
  • base_dd_max:3473.28
  • base_dd_mult:1.00
 
Streaking Star 7146 13.2% 99.0 2.83sec 21432 0 Direct 99.0 17359 35756 21434 22.1%  

Stats details: streaking_star

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.98 98.98 0.00 0.00 0.0000 0.0000 2121413.28 2121413.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.08 77.87% 17359.32 15764 19102 17360.85 16691 18351 1338028 1338028 0.00
crit 21.91 22.13% 35755.62 32473 39351 35757.21 34349 38008 783385 783385 0.00
 
 

Action details: streaking_star

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3430 6.4% 17.8 16.87sec 57658 60651 Direct 17.8 4261 8787 5271 22.3%  
Periodic 243.5 3092 6370 3819 22.2% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.75 17.75 243.51 243.51 0.9507 1.2154 1023672.09 1023672.09 0.00 3272.04 60651.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.79 77.69% 4261.27 3446 5197 4261.37 3949 4609 58774 58774 0.00
crit 3.96 22.31% 8786.72 7098 10707 8715.89 0 10707 34809 34809 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 189.5 77.81% 3092.17 4 3768 3093.15 3008 3197 585907 585907 0.00
crit 54.0 22.19% 6369.75 278 7762 6371.67 6073 6746 344182 344182 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Undulating Tides 1839 3.4% 54.9 5.35sec 9993 0 Direct 54.7 8127 16739 10030 22.1%  

Stats details: undulating_tides

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.95 54.75 0.00 0.00 0.0000 0.0000 549093.14 549093.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.65 77.90% 8126.81 7449 9027 8127.40 7869 8418 346603 346603 0.00
crit 12.10 22.10% 16738.56 15345 18595 16742.99 15999 17909 202490 202490 0.00
 
 

Action details: undulating_tides

Static Values
  • id:303389
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303389
  • name:Undulating Tides
  • school:frost
  • tooltip:
  • description:{$@spelldesc303008=Your damaging spells and abilities have a chance to crash a wave upon your target for {$s1=1870} Frost damage. When your health drops below {$s2=50}%, gain a shield absorbing {$s3=14665} damage within {$303390d=8 seconds}. When this occurs, Undulating Tides cannot trigger again for {$s4=45} sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6879.00
  • base_dd_max:6879.00
  • base_dd_mult:1.00
 
pet - guardian_of_azeroth 12801 / 2603
Azerite Spike 11448 4.3% 63.3 3.35sec 10850 11652 Direct 63.3 8899 17797 10851 21.9%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.30 63.30 0.00 0.00 0.9312 0.0000 686872.91 686872.91 0.00 11651.59 11651.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.42 78.07% 8898.51 8233 9070 8898.69 8726 9009 439768 439768 0.00
crit 13.88 21.93% 17797.48 16466 18139 17796.29 17389 18113 247105 247105 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295856
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295856
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:Strike your target with a shard of Azerite, dealing {$s1=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7602.61
  • base_dd_max:7602.61
  • base_dd_mult:1.00
 
Azerite Volley 1354 0.5% 6.0 39.29sec 13535 0 Direct 6.0 11162 22313 13535 21.3%  

Stats details: azerite_volley

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 81211.19 81211.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.72 78.72% 11162.28 10805 11336 11162.13 10871 11336 52721 52721 0.00
crit 1.28 21.28% 22312.52 21610 22672 16774.86 0 22672 28490 28490 0.00
 
 

Action details: azerite_volley

Static Values
  • id:303351
  • school:flamestrike
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303351
  • name:Azerite Volley
  • school:flamestrike
  • tooltip:
  • description:{$@spelldesc295841=Every $303347t1 sec, the Guardian of Azeroth will launch of volley of Azerite Spikes at the target area, dealing {$s1=2287} damage to all enemies near its target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9502.90
  • base_dd_max:9502.90
  • base_dd_mult:1.00
 
Simple Action Stats Execute Interval
fuse
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fuse
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.53sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.39sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8386 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Greater Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:298837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fuse
  • harmful:false
  • if_expr:
 
Well Fed (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:297039
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fuse
  • harmful:false
  • if_expr:
 
Guardian of Azeroth 2.0 180.47sec

Stats details: guardian_of_azeroth

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9784 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: guardian_of_azeroth

Static Values
  • id:295840
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
Spelldata
  • id:295840
  • name:Guardian of Azeroth
  • school:physical
  • tooltip:
  • description:Call upon Azeroth to summon a Guardian of Azeroth for {$300091d=30 seconds} who impales your target with spikes of Azerite every 2 sec that deal ${$295834m1*(1+$@versadmg)} Fire damage.$?a295841[ Every $303347t1 sec, the Guardian launches a volley of Azerite Spikes at its target, dealing {$295841s1=2287} Fire damage to all nearby enemies.][]$?a295843[ Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.][]
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Potion of Unbridled Fury (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:300714
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.8 57.9 41.0sec 4.6sec 93.90% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fuse
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:10.58%
  • arcanic_pulsar_2:10.59%
  • arcanic_pulsar_3:11.92%
  • arcanic_pulsar_4:11.96%
  • arcanic_pulsar_5:12.31%
  • arcanic_pulsar_6:9.99%
  • arcanic_pulsar_7:11.20%
  • arcanic_pulsar_8:15.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fuse
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.9sec 182.9sec 8.13% 12.52% 0.0(0.0) 2.0

Buff details

  • buff initial source:fuse
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.56% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:fuse
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 7.9 0.0 40.0sec 40.0sec 27.12% 34.25% 0.0(0.0) 7.7

Buff details

  • buff initial source:fuse
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:27.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Greater Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fuse
  • cooldown name:buff_greater_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:360.00

Stack Uptimes

  • greater_flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298837
  • name:Greater Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=360} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Guardian of Azeroth 2.0 61.3 180.7sec 3.3sec 19.45% 0.00% 53.3(53.3) 0.0

Buff details

  • buff initial source:fuse
  • cooldown name:buff_guardian_of_azeroth
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • guardian_of_azeroth_1:0.79%
  • guardian_of_azeroth_2:0.70%
  • guardian_of_azeroth_3:0.66%
  • guardian_of_azeroth_4:0.62%
  • guardian_of_azeroth_5:16.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295855
  • name:Guardian of Azeroth
  • tooltip:Haste increased by {$s1=2}%.
  • description:{$@spelldesc295843=Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.}
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Highborne Compendium of Storms 2.6 52.5 102.4sec 5.4sec 97.62% 0.00% 45.3(45.3) 1.6

Buff details

  • buff initial source:fuse
  • cooldown name:buff_highborne_compendium_of_storms
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Highborne Compendium of Storms

Stat Buff details

  • stat:haste_rating
  • amount:64.39

Stack Uptimes

  • highborne_compendium_of_storms_1:4.32%
  • highborne_compendium_of_storms_2:4.01%
  • highborne_compendium_of_storms_3:3.77%
  • highborne_compendium_of_storms_4:85.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:300919
  • name:Highborne Compendium of Storms
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc300913=Your spells have a chance to conjure a typhoon that travels towards enemies dealing {$300917s1=0} Nature damage and grant you $300919s~1 Haste for {$300919d=15 seconds}, up to ${$300919s*{$300919u=4}} Haste. }
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.32% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:fuse
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.97%
  • ignition_mages_fuse_2:3.92%
  • ignition_mages_fuse_3:3.86%
  • ignition_mages_fuse_4:3.81%
  • ignition_mages_fuse_5:3.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lifeblood 108.6 0.0 150.4sec 2.7sec 98.50% 0.00% 102.4(110.8) 0.0

Buff details

  • buff initial source:fuse
  • cooldown name:buff_lifeblood
  • max_stacks:4
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:229.17

Stack Uptimes

  • lifeblood_1:1.16%
  • lifeblood_2:1.26%
  • lifeblood_3:1.95%
  • lifeblood_4:94.12%

Trigger Attempt Success

  • trigger_pct:92.25%

Spelldata details

  • id:295137
  • name:Lifeblood
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by ${$w1+$w2+$w3}.
  • description:{$@spelldesc295078=Every {$s4=18}-{$s1=25} sec, a Lifeblood Shard erupts from the nearby ground for {$295114d=12 seconds}.$?!s295186&a295078[ $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within ${$m2*(1+($295160m1/100))} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.][]}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 37.6 49.4 8.1sec 3.4sec 81.21% 99.73% 2.3(2.3) 0.0

Buff details

  • buff initial source:fuse
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.63%
  • lunar_empowerment_2:30.08%
  • lunar_empowerment_3:15.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (mechdowels_big_mech) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fuse
  • cooldown name:buff_mechdowels_big_mech
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:93.00

Stack Uptimes

  • mechdowels_big_mech_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297039
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=93} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fuse
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overclocking Bit Band 17.8 0.0 17.2sec 17.3sec 87.10% 0.00% 0.0(0.0) 16.9

Buff details

  • buff initial source:fuse
  • cooldown name:buff_overclocking_bit_band
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:160.00

Stack Uptimes

  • overclocking_bit_band_1:87.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:301886
  • name:Overclocking Bit Band
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc300126=...then you gain {$s1=0} Haste for {$s2=15} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.7 4.2 62.9sec 30.8sec 51.54% 0.00% 4.2(58.6) 0.0

Buff details

  • buff initial source:fuse
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.43%
  • overwhelming_power_2:1.47%
  • overwhelming_power_3:1.51%
  • overwhelming_power_4:1.56%
  • overwhelming_power_5:1.61%
  • overwhelming_power_6:1.66%
  • overwhelming_power_7:1.71%
  • overwhelming_power_8:1.76%
  • overwhelming_power_9:1.82%
  • overwhelming_power_10:1.88%
  • overwhelming_power_11:1.93%
  • overwhelming_power_12:2.00%
  • overwhelming_power_13:2.06%
  • overwhelming_power_14:2.12%
  • overwhelming_power_15:2.19%
  • overwhelming_power_16:2.26%
  • overwhelming_power_17:2.34%
  • overwhelming_power_18:2.42%
  • overwhelming_power_19:2.50%
  • overwhelming_power_20:2.59%
  • overwhelming_power_21:2.68%
  • overwhelming_power_22:2.77%
  • overwhelming_power_23:2.86%
  • overwhelming_power_24:2.95%
  • overwhelming_power_25:1.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Unbridled Fury 2.0 0.0 188.4sec 0.0sec 39.87% 0.00% 0.0(0.0) 1.9

Buff details

  • buff initial source:fuse
  • cooldown name:buff_potion_of_unbridled_fury
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • potion_of_unbridled_fury_1:39.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:300714
  • name:Potion of Unbridled Fury
  • tooltip:Chance to deal an extra {$300717s1=3600} Fire damage to your current target.
  • description:Fill yourself with unbridled energy, giving your offensive spells and attacks a chance to do an additional {$300717s1=3600} Fire damage to your target. Lasts {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Prodigy's Potency 1.0 44.9 0.0sec 6.4sec 98.22% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fuse
  • cooldown name:buff_prodigys_potency
  • max_stacks:999
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prodigys_potency_1:1.48%
  • prodigys_potency_2:1.31%
  • prodigys_potency_3:1.34%
  • prodigys_potency_4:1.34%
  • prodigys_potency_5:1.49%
  • prodigys_potency_6:1.61%
  • prodigys_potency_7:1.90%
  • prodigys_potency_8:2.08%
  • prodigys_potency_9:2.25%
  • prodigys_potency_10:2.23%
  • prodigys_potency_11:2.43%
  • prodigys_potency_12:2.48%
  • prodigys_potency_13:2.45%
  • prodigys_potency_14:2.55%
  • prodigys_potency_15:2.42%
  • prodigys_potency_16:2.43%
  • prodigys_potency_17:2.39%
  • prodigys_potency_18:2.35%
  • prodigys_potency_19:2.42%
  • prodigys_potency_20:2.39%
  • prodigys_potency_21:2.39%
  • prodigys_potency_22:2.33%
  • prodigys_potency_23:2.40%
  • prodigys_potency_24:2.38%
  • prodigys_potency_25:2.27%
  • prodigys_potency_26:2.40%
  • prodigys_potency_27:2.28%
  • prodigys_potency_28:2.32%
  • prodigys_potency_29:2.19%
  • prodigys_potency_30:2.20%
  • prodigys_potency_31:2.21%
  • prodigys_potency_32:2.17%
  • prodigys_potency_33:2.05%
  • prodigys_potency_34:2.10%
  • prodigys_potency_35:2.15%
  • prodigys_potency_36:2.08%
  • prodigys_potency_37:2.05%
  • prodigys_potency_38:1.97%
  • prodigys_potency_39:1.85%
  • prodigys_potency_40:1.75%
  • prodigys_potency_41:1.61%
  • prodigys_potency_42:1.46%
  • prodigys_potency_43:1.37%
  • prodigys_potency_44:1.26%
  • prodigys_potency_45:1.09%
  • prodigys_potency_46:0.98%
  • prodigys_potency_47:0.94%
  • prodigys_potency_48:0.75%
  • prodigys_potency_49:0.72%
  • prodigys_potency_50:0.58%
  • prodigys_potency_51:0.52%
  • prodigys_potency_52:0.47%
  • prodigys_potency_53:0.37%
  • prodigys_potency_54:0.28%
  • prodigys_potency_55:0.26%
  • prodigys_potency_56:0.20%
  • prodigys_potency_57:0.18%
  • prodigys_potency_58:0.12%
  • prodigys_potency_59:0.09%
  • prodigys_potency_60:0.07%
  • prodigys_potency_61:0.04%
  • prodigys_potency_62:0.03%
  • prodigys_potency_63:0.03%
  • prodigys_potency_64:0.06%
  • prodigys_potency_65:0.04%
  • prodigys_potency_66:0.04%
  • prodigys_potency_67:0.02%
  • prodigys_potency_68:0.03%
  • prodigys_potency_69:0.03%
  • prodigys_potency_70:0.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:303017
  • name:Prodigy's Potency
  • tooltip:$w1 damage and healing stored.
  • description:
  • max_stacks:999
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
Solar Empowerment 29.5 53.3 10.1sec 3.6sec 83.48% 77.17% 0.2(0.2) 0.0

Buff details

  • buff initial source:fuse
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.76%
  • solar_empowerment_2:37.70%
  • solar_empowerment_3:15.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 50.6 20.2sec 4.6sec 98.03% 96.96% 20.4(20.4) 11.2

Buff details

  • buff initial source:fuse
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:12.86%
  • starlord_2:20.95%
  • starlord_3:64.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Strife 2.1 52.2 109.8sec 5.4sec 97.77% 0.00% 39.4(39.4) 1.1

Buff details

  • buff initial source:fuse
  • cooldown name:buff_strife
  • max_stacks:8
  • duration:14.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:53.82

Stack Uptimes

  • strife_1:3.71%
  • strife_2:3.62%
  • strife_3:3.52%
  • strife_4:3.43%
  • strife_5:3.34%
  • strife_6:3.23%
  • strife_7:3.11%
  • strife_8:73.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:304056
  • name:Strife
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc304081=Your spells and abilities have a chance to increase your Versatility by {$s1=0} for {$304056d=8 seconds}, stacking up to {$304056u=5} times. Being the vicitim of a loss of control or movement impairing effect also grants a stack of Strife.}
  • max_stacks:5
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 60.7sec 45.6sec 23.70% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:fuse
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.70%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
unempowered_solar_wrath 24.1 12.1sec
unempowered_lunar_strike 0.2 71.8sec
wasted_streaking_star 0.3 111.1sec
arcanic_pulsar_proc 6.9 42.1sec

Resources

Resource Usage Type Count Total Average RPE APR
fuse
starsurge Astral Power 65.9 2636.4 40.0 40.0 1634.7
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 104.94 839.47 (32.30%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.08%) 40.00 0.00 0.00%
sunfire Astral Power 17.75 53.27 (2.05%) 3.00 0.00 0.00%
shooting_stars Astral Power 49.07 196.26 (7.55%) 4.00 0.01 0.01%
moonfire Astral Power 14.18 42.53 (1.64%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.77 102.19 (3.93%) 8.00 0.00 0.00%
lunar_strike Astral Power 83.60 1003.16 (38.60%) 12.00 0.08 0.01%
natures_balance Astral Power 399.02 199.51 (7.68%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.85 82.24 (3.16%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.69 8.82
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.55 0.00 54.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data fuse Fight Length
Count 1192
Mean 298.89
Minimum 240.09
Maximum 359.91
Spread ( max - min ) 119.82
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data fuse Damage Per Second
Count 1192
Mean 53886.48
Minimum 49088.15
Maximum 59853.00
Spread ( max - min ) 10764.85
Range [ ( max - min ) / 2 * 100% ] 9.99%
Standard Deviation 1777.4191
5th Percentile 51263.61
95th Percentile 56926.37
( 95th Percentile - 5th Percentile ) 5662.76
Mean Distribution
Standard Deviation 51.4816
95.00% Confidence Intervall ( 53785.58 - 53987.39 )
Normalized 95.00% Confidence Intervall ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4180
0.1 Scale Factor Error with Delta=300 26969
0.05 Scale Factor Error with Delta=300 107876
0.01 Scale Factor Error with Delta=300 2696891
Priority Target DPS
Sample Data fuse Priority Target Damage Per Second
Count 1192
Mean 53886.48
Minimum 49088.15
Maximum 59853.00
Spread ( max - min ) 10764.85
Range [ ( max - min ) / 2 * 100% ] 9.99%
Standard Deviation 1777.4191
5th Percentile 51263.61
95th Percentile 56926.37
( 95th Percentile - 5th Percentile ) 5662.76
Mean Distribution
Standard Deviation 51.4816
95.00% Confidence Intervall ( 53785.58 - 53987.39 )
Normalized 95.00% Confidence Intervall ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4180
0.1 Scale Factor Error with Delta=300 26969
0.05 Scale Factor Error with Delta=300 107876
0.01 Scale Factor Error with Delta=300 2696891
DPS(e)
Sample Data fuse Damage Per Second (Effective)
Count 1192
Mean 53886.48
Minimum 49088.15
Maximum 59853.00
Spread ( max - min ) 10764.85
Range [ ( max - min ) / 2 * 100% ] 9.99%
Damage
Sample Data fuse Damage
Count 1192
Mean 15291341.61
Minimum 11944678.81
Maximum 18576529.35
Spread ( max - min ) 6631850.54
Range [ ( max - min ) / 2 * 100% ] 21.68%
DTPS
Sample Data fuse Damage Taken Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data fuse Healing Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data fuse Healing Per Second (Effective)
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data fuse Heal
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data fuse Healing Taken Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data fuse Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data fuseTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data fuse Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
Azerite variables
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
Starfall v Starsurge target cutoff
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6
F 2.00 berserking,if=buff.ca_inc.up
0.00 use_item,name=azsharas_font_of_power,if=equipped.169314&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
CDs
G 2.00 guardian_of_azeroth,if=(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
0.00 use_item,name=tidestorm_codex,if=equipped.165576
0.00 use_item,name=pocketsized_computation_device,if=equipped.167555&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
0.00 use_item,name=shiver_venom_relic,if=equipped.168905&cooldown.ca_inc.remains>30&!buff.ca_inc.up
H 2.96 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(!talent.stellar_flare.enabled|dot.stellar_flare.remains>10)&!buff.ca_inc.up&(astral_power<25|cooldown.ca_inc.remains>30)
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 focused_azerite_beam
0.00 thorns
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(buff.memory_of_lucid_dreams.up|ap_check)&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)
I 2.00 celestial_alignment,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 3.12 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
Spenders
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 65.91 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.99 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.48 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.37 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
DoTs
O 11.70 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.77 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
Generators
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 83.99 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 104.21 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.40 sunfire
Fallthru for movement

Sample Sequence

0123456789ACDKONPGIFHKRQKRQKRQKRQRNRORQRSKPKRQKQQQRRRRKRKRKRQRLQOQJKKQQPKRQRKRQRRNRRRRKOKQQRKPRKRQRLQQRRRKKOQQKRQRNRKPQRQRRRKKQORQKNRQRRRQPRJKRKRKRQHQKNOQQKRQRRRRKQKPQRKNQRQKOQRRRRRQKRKRQKRLPQKQOQKRQQRRKQNQGIEFKRKRPRKRQORQRQRJKNRQKRQKRQKRQRKQPQOQNKQKRQQRKQQRKQRRRNOPKRKRQRKLHQQQKQRRRRRQRRKKOPQNQKRQKRQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask fuse 58.0/100: 58% astral_power
Pre precombat 1 food fuse 58.0/100: 58% astral_power
Pre precombat 2 augmentation fuse 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power potion_of_unbridled_fury
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power potion_of_unbridled_fury
0:01.211 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, potion_of_unbridled_fury
0:02.116 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms, potion_of_unbridled_fury
0:02.998 default P stellar_flare Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency, potion_of_unbridled_fury
0:03.872 default G guardian_of_azeroth Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, lifeblood, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency, potion_of_unbridled_fury
0:04.747 default I celestial_alignment Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, lifeblood, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(2), potion_of_unbridled_fury
0:05.507 default F berserking Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, lifeblood, guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(2), potion_of_unbridled_fury
0:05.507 default H use_items Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(2), potion_of_unbridled_fury
0:05.507 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(2), potion_of_unbridled_fury, ignition_mages_fuse
0:06.261 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(2), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(2), potion_of_unbridled_fury, ignition_mages_fuse
0:07.015 default Q lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, lifeblood(2), guardian_of_azeroth(3), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(2), potion_of_unbridled_fury, ignition_mages_fuse
0:07.790 default K starsurge Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(2), overwhelming_power(25), potion_of_unbridled_fury, ignition_mages_fuse
0:08.543 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(2), overwhelming_power(24), strife, potion_of_unbridled_fury, ignition_mages_fuse
0:09.298 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(2), overwhelming_power(23), strife, potion_of_unbridled_fury, ignition_mages_fuse
0:10.051 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(2), overwhelming_power(22), strife, potion_of_unbridled_fury, ignition_mages_fuse(2)
0:10.805 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(2), overwhelming_power(22), strife, potion_of_unbridled_fury, ignition_mages_fuse(2)
0:11.561 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), overwhelming_power(21), strife(2), potion_of_unbridled_fury, ignition_mages_fuse(2)
0:12.316 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), overwhelming_power(20), strife(2), potion_of_unbridled_fury, ignition_mages_fuse(2)
0:13.071 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), overwhelming_power(19), strife(2), potion_of_unbridled_fury, ignition_mages_fuse(2)
0:13.825 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(19), strife(2), potion_of_unbridled_fury, ignition_mages_fuse(3)
0:14.579 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(18), strife(2), potion_of_unbridled_fury, ignition_mages_fuse(3)
0:15.334 default N sunfire Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(17), strife(3), potion_of_unbridled_fury, ignition_mages_fuse(3)
0:16.089 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(16), strife(3), potion_of_unbridled_fury, ignition_mages_fuse(3)
0:16.844 default O moonfire Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(16), strife(3), potion_of_unbridled_fury, ignition_mages_fuse(3)
0:17.599 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(15), strife(3), potion_of_unbridled_fury, ignition_mages_fuse(4)
0:18.354 default Q lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(14), strife(3), potion_of_unbridled_fury, ignition_mages_fuse(4)
0:19.109 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(13), strife(3), potion_of_unbridled_fury, ignition_mages_fuse(4)
0:19.864 default S sunfire Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(13), strife(3), potion_of_unbridled_fury, ignition_mages_fuse(4)
0:20.620 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(12), strife(4), potion_of_unbridled_fury, ignition_mages_fuse(4)
0:21.376 default P stellar_flare Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(11), strife(4), potion_of_unbridled_fury, ignition_mages_fuse(4)
0:22.132 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(24), strife(4), potion_of_unbridled_fury, ignition_mages_fuse(5)
0:22.888 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(24), strife(4), potion_of_unbridled_fury, ignition_mages_fuse(5)
0:23.643 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(23), strife(4), potion_of_unbridled_fury, ignition_mages_fuse(5)
0:24.398 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(22), strife(4), potion_of_unbridled_fury, ignition_mages_fuse(5)
0:25.153 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(21), strife(4), potion_of_unbridled_fury, ignition_mages_fuse(5)
0:25.908 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(21), strife(4), potion_of_unbridled_fury
0:26.789 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(20), strife(4), potion_of_unbridled_fury
0:27.670 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(19), strife(4), potion_of_unbridled_fury
0:28.425 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(18), strife(4), potion_of_unbridled_fury
0:29.179 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(17), strife(5), potion_of_unbridled_fury
0:29.934 default R solar_wrath Fluffy_Pillow 80.5/100: 81% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(17), strife(5), potion_of_unbridled_fury
0:30.690 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(16), strife(5), potion_of_unbridled_fury
0:31.446 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(15), strife(5), potion_of_unbridled_fury
0:32.201 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), overwhelming_power(14), strife(6), potion_of_unbridled_fury
0:32.954 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), overwhelming_power(14), strife(6), potion_of_unbridled_fury
0:33.710 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(13), strife(6), potion_of_unbridled_fury
0:34.461 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(12), strife(6), potion_of_unbridled_fury
0:35.215 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(11), strife(7), potion_of_unbridled_fury
0:36.098 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(10), strife(7), potion_of_unbridled_fury
0:36.853 default L sunfire Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(10), strife(7), potion_of_unbridled_fury
0:37.607 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(9), strife(7), potion_of_unbridled_fury
0:38.612 default O moonfire Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(8), strife(7), potion_of_unbridled_fury
0:39.405 default Q lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(7), strife(7), potion_of_unbridled_fury
0:40.417 default J cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(6), strife(7), potion_of_unbridled_fury
0:40.417 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(6), strife(7), potion_of_unbridled_fury
0:41.286 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(5), strife(7), potion_of_unbridled_fury
0:42.387 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(4), strife(7), potion_of_unbridled_fury
0:43.756 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(3), strife(7), potion_of_unbridled_fury
0:45.126 default P stellar_flare Fluffy_Pillow 37.0/100: 37% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power, strife(7), potion_of_unbridled_fury
0:46.210 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(7), potion_of_unbridled_fury
0:47.299 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(7), potion_of_unbridled_fury
0:48.198 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(7), potion_of_unbridled_fury
0:49.545 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife, potion_of_unbridled_fury
0:50.444 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife, potion_of_unbridled_fury
0:51.502 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(12), strife, potion_of_unbridled_fury
0:52.419 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(12), strife, potion_of_unbridled_fury
0:53.793 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), strife(2), potion_of_unbridled_fury
0:54.692 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), strife(2), potion_of_unbridled_fury
0:55.591 default N sunfire Fluffy_Pillow 40.0/100: 40% astral_power lifeblood(4), arcanic_pulsar(6), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), strife(2), potion_of_unbridled_fury
0:56.649 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power lifeblood(4), arcanic_pulsar(6), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), strife(2), potion_of_unbridled_fury
0:57.708 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power lifeblood(4), arcanic_pulsar(6), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), strife(2), potion_of_unbridled_fury
0:58.765 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power lifeblood(4), arcanic_pulsar(6), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), strife(2)
0:59.825 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power lifeblood(4), arcanic_pulsar(6), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), strife(2)
1:00.883 default K starsurge Fluffy_Pillow 78.5/100: 79% astral_power lifeblood(4), arcanic_pulsar(6), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), strife(2)
1:02.038 default O moonfire Fluffy_Pillow 39.0/100: 39% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), strife(2)
1:03.157 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), strife(3)
1:04.278 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), strife(3)
1:05.665 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(13), strife(4)
1:07.051 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(13), strife(4)
1:07.976 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(13), strife(4)
1:09.066 default P stellar_flare Fluffy_Pillow 19.0/100: 19% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(13), strife(4)
1:10.004 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(13), strife(4)
1:10.801 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(13), strife(4)
1:11.738 default R solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(14), strife(4)
1:12.522 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(14), strife(4)
1:13.694 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(15), strife(4)
1:14.477 default L sunfire Fluffy_Pillow 34.5/100: 35% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(15), strife(4)
1:15.396 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(15), strife(4)
1:16.744 default Q lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(15), strife(4)
1:18.088 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power lifeblood(4), arcanic_pulsar, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(15), strife(5)
1:18.987 default R solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power lifeblood(4), arcanic_pulsar, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(15), strife(5)
1:20.045 default R solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power lifeblood(4), arcanic_pulsar, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(15), strife(5)
1:21.104 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power lifeblood(4), arcanic_pulsar, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), strife(6)
1:22.258 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), strife(6)
1:23.377 default O moonfire Fluffy_Pillow 15.5/100: 16% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(17), strife(6)
1:24.467 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(17), overwhelming_power(24), strife(6)
1:25.747 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(17), overwhelming_power(23), strife(7)
1:27.030 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(2), highborne_compendium_of_storms(4), prodigys_potency(17), overwhelming_power(21), strife(7)
1:28.061 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(17), overwhelming_power(20), strife(7)
1:28.915 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), overwhelming_power(20), strife(8)
1:30.176 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), overwhelming_power(18), strife(8)
1:31.023 default N sunfire Fluffy_Pillow 35.5/100: 36% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), overwhelming_power(17), strife(8)
1:32.022 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), overwhelming_power(16), strife(8)
1:32.874 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power lifeblood(4), arcanic_pulsar(4), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), overwhelming_power(16), strife(8)
1:33.875 default P stellar_flare Fluffy_Pillow 8.5/100: 9% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), overwhelming_power(15), strife(8)
1:34.879 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), overwhelming_power(14), strife(8)
1:36.163 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), overwhelming_power(12), strife(8)
1:37.027 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), overwhelming_power(11), strife(8)
1:38.325 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), overwhelming_power(10), strife(8)
1:39.196 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power lifeblood(4), arcanic_pulsar(5), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), overwhelming_power(9), strife(8)
1:40.223 default R solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power lifeblood(4), arcanic_pulsar(5), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(8), strife(8)
1:41.253 default K starsurge Fluffy_Pillow 81.5/100: 82% astral_power lifeblood(4), arcanic_pulsar(5), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(7), strife(8)
1:42.379 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(6), strife(8)
1:43.475 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(5), strife(8)
1:44.838 default O moonfire Fluffy_Pillow 15.5/100: 16% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(4), strife(8)
1:45.932 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(3), strife(8)
1:46.849 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(2), strife(8)
1:48.225 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), strife(8)
1:49.313 default N sunfire Fluffy_Pillow 5.5/100: 6% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), strife(8)
1:50.372 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), strife(8)
1:51.273 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), strife(8)
1:52.621 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), strife(8)
1:53.519 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), strife(8)
1:54.420 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), strife(8)
1:55.478 default Q lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), strife(8)
1:56.825 default P stellar_flare Fluffy_Pillow 77.5/100: 78% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), strife(8)
1:57.885 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), strife(8)
1:58.945 default J cancel_buff Fluffy_Pillow 95.0/100: 95% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife(8)
1:58.945 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power lifeblood(4), arcanic_pulsar(8), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife(8)
2:00.098 default R solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, highborne_compendium_of_storms(4), prodigys_potency(20), strife(8)
2:00.943 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, starlord, highborne_compendium_of_storms(4), prodigys_potency(20), strife(8)
2:01.934 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), highborne_compendium_of_storms(4), prodigys_potency(20), strife(8)
2:02.755 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), highborne_compendium_of_storms(4), prodigys_potency(20), strife(8)
2:03.721 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(20), strife(8)
2:04.520 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(20), strife(8)
2:05.714 default H use_items Fluffy_Pillow 31.5/100: 32% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife
2:05.714 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife, ignition_mages_fuse
2:07.009 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife, ignition_mages_fuse
2:08.027 default N sunfire Fluffy_Pillow 9.0/100: 9% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife, ignition_mages_fuse
2:09.044 default O moonfire Fluffy_Pillow 13.0/100: 13% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife, ignition_mages_fuse
2:10.062 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(20), strife(2), ignition_mages_fuse(2)
2:11.307 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(20), strife(2), ignition_mages_fuse(2)
2:12.553 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(21), strife(2), ignition_mages_fuse(2)
2:13.531 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(21), strife(2), ignition_mages_fuse(2)
2:14.361 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(21), strife(2), ignition_mages_fuse(3)
2:15.561 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(21), strife(2), ignition_mages_fuse(3)
2:16.364 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(22), strife(2), ignition_mages_fuse(3)
2:17.165 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power lifeblood(4), arcanic_pulsar(4), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(22), strife(2), ignition_mages_fuse(3)
2:18.106 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power lifeblood(4), arcanic_pulsar(4), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), strife(2), ignition_mages_fuse(4)
2:19.016 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power lifeblood(4), arcanic_pulsar(4), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(24), strife(2), ignition_mages_fuse(4)
2:19.942 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(24), strife(2), ignition_mages_fuse(4)
2:21.085 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment, starlord, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(22), strife(2), ignition_mages_fuse(4)
2:22.001 default P stellar_flare Fluffy_Pillow 4.5/100: 5% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(21), strife(2), ignition_mages_fuse(5)
2:22.866 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(21), strife(3), ignition_mages_fuse(5)
2:23.950 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(20), strife(3), ignition_mages_fuse(5)
2:24.705 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(19), strife(3), ignition_mages_fuse(5)
2:25.559 default N sunfire Fluffy_Pillow 3.0/100: 3% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(18), strife(3), ignition_mages_fuse(5)
2:26.391 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(25), overwhelming_power(17), strife(4)
2:27.664 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(26), overwhelming_power(16), strife(4)
2:28.518 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(26), overwhelming_power(15), strife(4)
2:29.799 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(26), overwhelming_power(14), strife(5)
2:30.810 default O moonfire Fluffy_Pillow 1.5/100: 2% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(26), overwhelming_power(13), strife(5)
2:31.822 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), overwhelming_power(12), strife(5)
2:33.118 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(26), overwhelming_power(10), strife(5)
2:33.987 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(26), overwhelming_power(10), strife(5)
2:34.858 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(26), overwhelming_power(9), strife(5)
2:35.884 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(26), overwhelming_power(25), strife(5)
2:36.857 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(26), overwhelming_power(24), strife(5)
2:37.834 default Q lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(26), overwhelming_power(23), strife(5)
2:39.082 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power lifeblood(4), arcanic_pulsar(8), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(26), overwhelming_power(21), strife(6)
2:40.174 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), overwhelming_power(20), strife(6)
2:40.949 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), overwhelming_power(20), strife(6)
2:41.860 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), overwhelming_power(19), strife(6)
2:42.616 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), overwhelming_power(18), strife(6)
2:43.752 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), overwhelming_power(17), strife(6)
2:44.645 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(28), overwhelming_power(16), strife(6)
2:45.400 default L sunfire Fluffy_Pillow 22.0/100: 22% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(28), overwhelming_power(15), strife(6)
2:46.275 default P stellar_flare Fluffy_Pillow 25.5/100: 26% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(28), overwhelming_power(14), strife(7)
2:47.284 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(28), overwhelming_power(13), strife(7)
2:48.573 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(12), strife(7)
2:49.588 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(11), strife(8)
2:50.887 default O moonfire Fluffy_Pillow 20.5/100: 21% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(10), strife(8)
2:51.909 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(9), strife(8)
2:53.218 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(7), strife(8)
2:54.251 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(6), strife(8)
2:55.148 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(5), strife(8)
2:56.498 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(24), strife(8)
2:57.762 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(23), strife(8)
2:58.610 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(22), strife(8)
2:59.460 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(21), strife(8)
3:00.553 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(20), strife(8)
3:01.885 default N sunfire Fluffy_Pillow 35.0/100: 35% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(19), strife(8)
3:02.935 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(18), strife(8)
3:04.276 default G guardian_of_azeroth Fluffy_Pillow 51.5/100: 52% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(16), strife(8)
3:05.337 default I celestial_alignment Fluffy_Pillow 52.5/100: 53% astral_power lifeblood(4), arcanic_pulsar(5), celestial_alignment, solar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(15), strife(8)
3:06.262 default E potion Fluffy_Pillow 93.0/100: 93% astral_power lifeblood(4), guardian_of_azeroth, arcanic_pulsar(5), celestial_alignment, solar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(14), strife(8)
3:06.262 default F berserking Fluffy_Pillow 93.0/100: 93% astral_power lifeblood(4), guardian_of_azeroth, arcanic_pulsar(5), celestial_alignment, solar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(14), strife(8), potion_of_unbridled_fury
3:06.262 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power berserking, lifeblood(4), guardian_of_azeroth, arcanic_pulsar(5), celestial_alignment, solar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(14), strife(8), potion_of_unbridled_fury
3:07.091 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power berserking, lifeblood(4), guardian_of_azeroth(2), arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(13), strife(8), potion_of_unbridled_fury
3:07.846 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power berserking, lifeblood(4), guardian_of_azeroth(2), arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(13), strife(8), potion_of_unbridled_fury
3:08.639 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power berserking, lifeblood(4), guardian_of_azeroth(3), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(12), strife(8), potion_of_unbridled_fury
3:09.393 default P stellar_flare Fluffy_Pillow 31.0/100: 31% astral_power berserking, lifeblood(4), guardian_of_azeroth(4), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(11), strife(8), potion_of_unbridled_fury
3:10.147 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(10), strife(8), potion_of_unbridled_fury
3:10.901 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(10), strife(8), potion_of_unbridled_fury
3:11.656 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(9), strife(8), potion_of_unbridled_fury
3:12.410 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(8), strife(8), potion_of_unbridled_fury
3:13.354 default O moonfire Fluffy_Pillow 33.5/100: 34% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(7), strife(8), potion_of_unbridled_fury
3:14.108 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(6), strife(8), potion_of_unbridled_fury
3:14.862 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(6), strife(8), potion_of_unbridled_fury
3:15.831 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(5), strife(8), potion_of_unbridled_fury
3:16.585 default Q lunar_strike Fluffy_Pillow 71.0/100: 71% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), overwhelming_power(4), strife(8), potion_of_unbridled_fury
3:17.540 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), overwhelming_power(3), strife(8), potion_of_unbridled_fury
3:18.294 default J cancel_buff Fluffy_Pillow 92.0/100: 92% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), overwhelming_power(2), strife(8), potion_of_unbridled_fury
3:18.294 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), overwhelming_power(2), strife(8), potion_of_unbridled_fury
3:19.201 default N sunfire Fluffy_Pillow 64.5/100: 65% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), overwhelming_power, strife(8), potion_of_unbridled_fury
3:20.082 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:20.836 default Q lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:21.965 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:22.850 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:23.605 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:24.702 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:25.561 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:26.314 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:27.378 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:28.215 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:28.968 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:30.034 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:30.872 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:31.723 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:32.971 default P stellar_flare Fluffy_Pillow 20.5/100: 21% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:33.934 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:35.158 default O moonfire Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:36.216 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:37.566 default N sunfire Fluffy_Pillow 63.0/100: 63% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:38.623 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:39.776 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(33), overwhelming_power(24), strife(8), potion_of_unbridled_fury
3:41.093 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(33), overwhelming_power(22), strife(8), potion_of_unbridled_fury
3:42.135 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(33), overwhelming_power(21), strife(8), potion_of_unbridled_fury
3:42.997 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(33), overwhelming_power(21), strife(8), potion_of_unbridled_fury
3:44.287 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(33), overwhelming_power(19), strife(8), potion_of_unbridled_fury
3:45.585 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(33), overwhelming_power(18), strife(8), potion_of_unbridled_fury
3:46.456 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(33), overwhelming_power(17), strife(8), potion_of_unbridled_fury
3:47.484 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(34), overwhelming_power(16), strife(8), potion_of_unbridled_fury
3:48.761 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(34), overwhelming_power(15), strife(8), potion_of_unbridled_fury
3:50.063 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(34), overwhelming_power(24), strife(8), potion_of_unbridled_fury
3:50.907 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(34), overwhelming_power(24), strife(8), potion_of_unbridled_fury
3:51.901 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(34), overwhelming_power(23), strife(8), potion_of_unbridled_fury
3:53.149 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(34), overwhelming_power(21), strife(8), potion_of_unbridled_fury
3:53.987 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(34), overwhelming_power(21), strife(8), potion_of_unbridled_fury
3:54.826 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(34), overwhelming_power(20), strife(8), potion_of_unbridled_fury
3:55.815 default N sunfire Fluffy_Pillow 50.0/100: 50% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(34), overwhelming_power(19), strife(8), potion_of_unbridled_fury
3:56.807 default O moonfire Fluffy_Pillow 53.5/100: 54% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(34), overwhelming_power(18), strife(8), potion_of_unbridled_fury
3:57.801 default P stellar_flare Fluffy_Pillow 57.5/100: 57% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(34), overwhelming_power(17), strife(8), potion_of_unbridled_fury
3:58.801 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power lifeblood(4), arcanic_pulsar(8), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(35), overwhelming_power(16), strife(8), potion_of_unbridled_fury
3:59.895 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(36), overwhelming_power(15), strife(8), potion_of_unbridled_fury
4:00.682 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(36), overwhelming_power(14), strife(8), potion_of_unbridled_fury
4:01.611 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(36), overwhelming_power(13), strife(8), potion_of_unbridled_fury
4:02.380 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(36), overwhelming_power(12), strife(8), potion_of_unbridled_fury
4:03.535 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(11), strife(8), potion_of_unbridled_fury
4:04.309 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(10), strife(8), potion_of_unbridled_fury
4:05.224 default L sunfire Fluffy_Pillow 2.0/100: 2% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(9), strife(8), potion_of_unbridled_fury
4:06.117 default H use_items Fluffy_Pillow 6.0/100: 6% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(8), strife(8), potion_of_unbridled_fury
4:06.117 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(8), strife(8), potion_of_unbridled_fury, ignition_mages_fuse
4:07.401 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(7), strife(8), ignition_mages_fuse
4:08.687 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(6), strife(8), ignition_mages_fuse
4:09.977 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(25), strife(8), ignition_mages_fuse
4:10.930 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(24), strife(8), ignition_mages_fuse(2)
4:12.105 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(22), strife(8), ignition_mages_fuse(2)
4:12.893 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(22), strife(8), ignition_mages_fuse(2)
4:13.668 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(21), strife(8), ignition_mages_fuse(2)
4:14.584 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(20), strife(8), ignition_mages_fuse(3)
4:15.471 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(19), strife(8), ignition_mages_fuse(3)
4:16.362 default Q lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(18), strife(8), ignition_mages_fuse(3)
4:17.498 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(38), overwhelming_power(17), strife(8), ignition_mages_fuse(3)
4:18.394 default R solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(38), overwhelming_power(16), strife(8), ignition_mages_fuse(4)
4:19.263 default K starsurge Fluffy_Pillow 98.5/100: 99% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(38), overwhelming_power(15), strife(8), ignition_mages_fuse(4)
4:20.212 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(38), overwhelming_power(14), strife(8), ignition_mages_fuse(4)
4:21.135 default O moonfire Fluffy_Pillow 24.0/100: 24% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(38), overwhelming_power(13), strife(8), ignition_mages_fuse(4)
4:22.034 default P stellar_flare Fluffy_Pillow 27.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(38), overwhelming_power(12), strife(8), ignition_mages_fuse(4)
4:22.937 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(38), overwhelming_power(12), strife(8), ignition_mages_fuse(5)
4:24.048 default N sunfire Fluffy_Pillow 49.0/100: 49% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(38), overwhelming_power(10), strife(8), ignition_mages_fuse(5)
4:24.926 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(38), overwhelming_power(10), strife(8), ignition_mages_fuse(5)
4:26.042 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power lifeblood(3), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(39), overwhelming_power(8), strife(8), ignition_mages_fuse(5)
4:26.926 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power lifeblood(3), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(39), overwhelming_power(8), strife(8)
4:27.800 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(40), overwhelming_power(7), strife(8)
4:29.117 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(41), overwhelming_power(5), strife(8)
4:30.174 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(41), overwhelming_power(4), strife(8)
4:31.062 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(41), overwhelming_power(3), strife(8)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16715 15195 12905
Intellect 1467 -3 12859 11249 9250 (5789)
Spirit 0 0 0 0 0
Health 334300 303900 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 12859 11249 0
Crit 22.17% 20.88% 1143
Haste 24.38% 24.38% 1658
Damage / Heal Versatility 3.13% 3.13% 266
ManaReg per Second 2396 640 0
Attack Power 13373 11699 0
Mastery 37.17% 37.17% 1162
Armor 2828 2828 2828
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 435.00
Local Head Shroud of Unmooring Whispers
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
azerite powers: { Streaking Stars, Arcanic Pulsar, Overwhelming Power }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Shoulderpads of Frothing Rage
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
azerite powers: { Streaking Stars, Loyal to the End, Heed My Call }
Local Chest Tunic of the Sycophant
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
azerite powers: { Streaking Stars, Undulating Tides, Gutripper }
Local Waist Vim's Scalecrusher Clasp
ilevel: 425, stats: { 233 Armor, +358 AgiInt, +637 Sta, +102 Crit, +111 Haste }, gems: { +50 Haste }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Akana's Reefstrider Footwraps
ilevel: 425, stats: { 285 Armor, +358 AgiInt, +637 Sta, +102 Mastery, +111 Haste }, gems: { +50 Haste }
Local Wrists Ori's Tidal Wristwraps
ilevel: 425, stats: { 181 Armor, +268 AgiInt, +478 Sta, +87 Vers, +73 Haste }, gems: { +50 Haste }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Overclocking Bit Band
ilevel: 415, stats: { +430 Sta, +388 Haste, +97 Mastery }, enchant: { +60 Crit }
Local Finger2 Logic Loop of Recursion
ilevel: 415, stats: { +430 Sta, +361 Crit, +124 Haste }, enchant: { +60 Crit }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Highborne Compendium of Storms
ilevel: 400, stats: { +359 Int }
Local Back Shirakess Drape
ilevel: 425, stats: { 122 Armor, +268 StrAgiInt, +478 Sta, +83 Haste, +77 Mastery }, gems: { +50 Haste }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="fuse"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
professions=engineering=100/jewelcrafting=100
talents=1000231
azerite_essences=14:3:1/32:3:0/4:3:0

# Default consumables
potion=unbridled_fury
flask=greater_flask_of_endless_fathoms
food=mechdowels_big_mech
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Azerite variables
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
# Starfall v Starsurge target cutoff
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6
actions+=/berserking,if=buff.ca_inc.up
# CDs
actions+=/use_item,name=azsharas_font_of_power,if=equipped.169314&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/guardian_of_azeroth,if=(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_item,name=pocketsized_computation_device,if=equipped.167555&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/use_item,name=shiver_venom_relic,if=equipped.168905&cooldown.ca_inc.remains>30&!buff.ca_inc.up
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(!talent.stellar_flare.enabled|dot.stellar_flare.remains>10)&!buff.ca_inc.up&(astral_power<25|cooldown.ca_inc.remains>30)
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/focused_azerite_beam
actions+=/thorns
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(buff.memory_of_lucid_dreams.up|ap_check)&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)
actions+=/celestial_alignment,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
# Spenders
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
# DoTs
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
# Generators
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
# Fallthru for movement
actions+=/sunfire

head=shroud_of_unmooring_whispers,id=168349,ilevel=450,azerite_powers=122/200/30
neck=heart_of_azeroth,id=158075,ilevel=463,azerite_level=65
shoulders=shoulderpads_of_frothing_rage,id=168348,ilevel=450,azerite_powers=122/576/22
back=shirakess_drape,id=169486,ilevel=425,gems=50haste
chest=tunic_of_the_sycophant,id=168350,ilevel=450,azerite_powers=122/575/31
wrists=oris_tidal_wristwraps,id=170305,ilevel=425,gems=50haste
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=vims_scalecrusher_clasp,id=170368,ilevel=425,gems=50haste
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=akanas_reefstrider_footwraps,id=170141,ilevel=425,gems=50haste
finger1=overclocking_bit_band,id=169159,ilevel=415,enchant=60crit
finger2=logic_loop_of_recursion,id=169158,ilevel=415,enchant=60crit
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=highborne_compendium_of_storms,id=169328,ilevel=400
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=434.87
# gear_stamina=12905
# gear_intellect=9250
# gear_crit_rating=1143
# gear_haste_rating=1658
# gear_mastery_rating=805
# gear_versatility_rating=266
# gear_armor=2828

leviathans : 54789 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
54789.2 54789.2 103.7 / 0.189% 7083.1 / 12.9% 6008.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.7 8.5 Astral Power 0.00% 61.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator
Professions
  • engineering: 100
  • jewelcrafting: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
leviathans 54789
Azerite Spike 1005 1.8% 17.7 16.37sec 16993 0 Direct 17.7 13803 28434 17014 21.9%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.69 17.67 0.00 0.00 0.0000 0.0000 300605.55 300605.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.80 78.08% 13803.16 12665 15347 13800.19 13180 14932 190463 190463 0.00
crit 3.87 21.92% 28433.53 26090 31616 27793.82 0 31616 110142 110142 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295835
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:90.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295835
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:{$@spelldesc295834=Your spells and abilities have a high chance to impale your target with a spike of Azerite, causing ${$m1*(1+$@versadmg)} Fire damage.$?a295837[ When an Azerite spike deals damage, all damage you deal against that target is increased by {$295838s1=5}% for {$295838d=6 seconds}.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11696.33
  • base_dd_max:11696.33
  • base_dd_mult:1.00
 
Conch Strike 370 0.7% 13.2 21.12sec 8401 0 Direct 13.1 6838 14091 8476 22.6%  

Stats details: conch_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.17 13.05 0.00 0.00 0.0000 0.0000 110619.13 158027.33 30.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.11 77.43% 6838.15 6415 7067 6838.75 6632 7046 69115 98736 30.00
crit 2.95 22.57% 14090.99 13215 14558 13414.84 0 14558 41504 59292 28.57
 
 

Action details: conch_strike

Static Values
  • id:304698
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:304698
  • name:Conch Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc304697=While in Nazjatar or the Eternal Palace, your spells and abilities have a chance to deal Physical damage and increased threat to enemies in a small area around the target. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8462.82
  • base_dd_max:8462.82
  • base_dd_mult:1.00
 
Frost Blast 577 1.1% 13.3 21.22sec 12964 0 Direct 13.3 10497 21636 12965 22.1%  

Stats details: frost_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.27 13.27 0.00 0.00 0.0000 0.0000 171974.25 171974.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.33 77.85% 10497.32 9623 11661 10497.56 9978 11185 108407 108407 0.00
crit 2.94 22.15% 21635.65 19824 24023 20722.65 0 24023 63567 63567 0.00
 
 

Action details: frost_blast

Static Values
  • id:304645
  • school:frost
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:304645
  • name:Frost Blast
  • school:frost
  • tooltip:Slowed.
  • description:{$@spelldesc304640=While in Nazjatar or the Eternal Palace, your spells and abilities have a chance to deal {$304645s1=0} Frost damage to your target, slowing them for {$304645d=6 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8887.35
  • base_dd_max:8887.35
  • base_dd_mult:1.00
 
Gutripper 523 1.0% 38.2 7.64sec 4080 0 Direct 38.2 3308 6814 4080 22.0%  

Stats details: gutripper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.20 38.20 0.00 0.00 0.0000 0.0000 155873.95 222677.07 30.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.79 77.97% 3307.88 3100 3415 3309.00 3245 3388 98536 140766 30.00
crit 8.41 22.03% 6814.30 6386 7035 6817.33 6539 7035 57338 81912 30.00
 
 

Action details: gutripper

Static Values
  • id:269031
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:269031
  • name:Gutripper
  • school:physical
  • tooltip:
  • description:{$@spelldesc266937=Your damaging abilities have a chance to deal {$s1=1112} Physical damage to the target. Gutripper occurs much more often against targets below {$s2=30}% health. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4090.00
  • base_dd_max:4090.00
  • base_dd_mult:1.00
 
Heed My Call 346 (494) 0.6% (0.9%) 8.7 31.02sec 16882 0 Direct 8.7 9577 19719 11839 22.3%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.74 8.74 0.00 0.00 0.0000 0.0000 103465.72 103465.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.79 77.69% 9576.54 8778 10637 9569.92 0 10637 65021 65021 0.00
crit 1.95 22.31% 19719.38 18082 21912 16856.30 0 21912 38444 38444 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 148 0.3% 8.7 31.02sec 5043 0 Direct 8.7 4105 8446 5043 21.6%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.74 8.74 0.00 0.00 0.0000 0.0000 44067.69 44067.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.85 78.40% 4104.97 3762 4559 4106.04 3845 4425 28126 28126 0.00
crit 1.89 21.60% 8445.51 7749 9391 7023.49 0 9391 15942 15942 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Leviathan Chomp 1997 3.7% 13.1 21.50sec 45606 0 Direct 13.0 37086 76396 45814 22.2%  

Stats details: leviathan_chomp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.09 13.04 0.00 0.00 0.0000 0.0000 597204.15 853148.79 30.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.14 77.81% 37085.65 34792 38328 37087.12 36014 37963 376172 537388 30.00
crit 2.89 22.19% 76396.38 71672 78956 72893.26 0 78956 221032 315761 28.62
 
 

Action details: leviathan_chomp

Static Values
  • id:302763
  • school:physical
  • resource:none
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:302763
  • name:Leviathan Chomp
  • school:physical
  • tooltip:
  • description:{$@spelldesc302773=Your damaging abilities have a very low chance to summon a Leviathan, inflicting ${$s2*(1+$@versadmg)} Physical damage to your target. Dealing damage also cultivates luminous algae on your target, increasing your chance to summon.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:45899.54
  • base_dd_max:45899.54
  • base_dd_mult:1.00
 
Lunar Strike 6274 11.5% 82.2 3.54sec 22797 18702 Direct 82.2 18490 38100 22793 22.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.19 82.19 0.00 0.00 1.2190 0.0000 1873655.63 1873655.63 0.00 18701.77 18701.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.14 78.04% 18490.27 10911 22778 18496.76 17910 19207 1186057 1186057 0.00
crit 18.05 21.96% 38100.16 25241 46923 38105.90 35459 40734 687599 687599 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3006 5.5% 14.2 21.22sec 63315 66211 Direct 14.2 3076 6333 3808 22.5%  
Periodic 237.7 2874 5920 3549 22.1% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.17 14.17 237.67 237.67 0.9563 1.2490 897355.97 897355.97 0.00 2890.87 66210.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.99 77.55% 3076.04 2498 3768 3075.99 2801 3356 33806 33806 0.00
crit 3.18 22.45% 6332.87 5146 7762 6164.92 0 7762 20155 20155 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 185.1 77.86% 2874.24 2 3508 2875.08 2796 3011 531882 531882 0.00
crit 52.6 22.14% 5920.22 8 7227 5921.85 5663 6227 311513 311513 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Potion of Unbridled Fury 1411 2.6% 79.1 3.12sec 5270 0 Direct 79.1 4273 8809 5270 22.0%  

Stats details: potion_of_unbridled_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.07 79.07 0.00 0.00 0.0000 0.0000 416657.45 416657.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.69 78.02% 4272.67 3898 4724 4272.81 4123 4512 263587 263587 0.00
crit 17.38 21.98% 8809.08 8030 9731 8808.79 8389 9351 153070 153070 0.00
 
 

Action details: potion_of_unbridled_fury

Static Values
  • id:300717
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:300717
  • name:Potion of Unbridled Fury
  • school:fire
  • tooltip:
  • description:Deal {$s1=3600} Fire damage to your current target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3600.00
  • base_dd_max:3600.00
  • base_dd_mult:1.00
 
Shooting Stars 1098 2.0% 47.4 6.15sec 6916 0 Direct 47.4 5596 11511 6916 22.3%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.40 47.40 0.00 0.00 0.0000 0.0000 327770.98 327770.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.82 77.69% 5595.97 4522 6820 5598.04 5323 6022 206067 206067 0.00
crit 10.57 22.31% 11510.95 9314 14049 11514.76 10577 12841 121704 121704 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3945 (5690) 7.2% (10.4%) 101.7 2.88sec 16701 19313 Direct 102.2 9344 19238 11526 22.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.74 102.21 0.00 0.00 0.8647 0.0000 1178000.54 1178000.54 0.00 19313.23 19313.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.68 77.96% 9344.07 7536 11367 9347.79 9052 9685 744516 744516 0.00
crit 22.53 22.04% 19238.33 15524 23415 19245.29 18109 20738 433485 433485 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (_empowered) 1745 3.2% 78.9 3.69sec 6606 0 Direct 78.9 6607 0 6607 0.0%  

Stats details: solar_wrath_empowered

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.88 78.88 0.00 0.00 0.0000 0.0000 521099.98 521099.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.88 100.00% 6606.62 4411 13347 6608.27 5782 7549 521100 521100 0.00
 
 

Action details: solar_wrath_empowered

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4649.23
  • base_dd_max:4649.23
  • base_dd_mult:1.00
 
Starsurge 14200 26.0% 64.8 4.64sec 65377 66231 Direct 64.6 53069 109257 65583 22.3%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.82 64.62 0.00 0.00 0.9871 0.0000 4237962.92 4237962.92 0.00 66230.59 66230.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.22 77.73% 53068.66 43153 64684 53086.82 51302 55596 2665418 2665418 0.00
crit 14.39 22.27% 109257.05 88895 133248 109284.82 99902 120350 1572545 1572545 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1962 3.6% 12.8 23.56sec 45906 47403 Direct 12.8 2637 5429 3266 22.5%  
Periodic 235.6 1868 3847 2308 22.3% 98.5%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.76 12.76 235.62 235.62 0.9685 1.2492 585573.35 585573.35 0.00 1909.43 47403.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.88 77.47% 2636.75 2154 3248 2637.57 2452 2861 26057 26057 0.00
crit 2.87 22.53% 5428.89 4436 6692 5169.28 0 6692 15603 15603 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 183.1 77.73% 1867.74 74 2274 1868.38 1818 1947 342074 342074 0.00
crit 52.5 22.27% 3846.73 359 4684 3848.33 3671 4086 201839 201839 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Storm of the Eternal 528 1.0% 6.0 120.00sec 25966 0 Direct 6.0 21095 43461 26062 22.2%  

Stats details: storm_of_the_eternal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 5.98 0.00 0.00 0.0000 0.0000 155798.45 155798.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.65 77.80% 21095.36 19370 23473 21101.05 19490 23473 98112 98112 0.00
crit 1.33 22.20% 43461.31 39903 48353 33834.12 0 48353 57687 57687 0.00
 
 

Action details: storm_of_the_eternal

Static Values
  • id:303725
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303725
  • name:Storm of the Eternal
  • school:arcane
  • tooltip:
  • description:{$@spelldesc303733=Storm of the Eternal rises for {$303723d=10 seconds} every {$303722d=120 seconds}, dealing ${{$s1=0}*(1+$@versadmg)} Arcane damage {$303724u=3} times to a random enemy within $303725A1 yds. All Storm of the Eternal effects occur simultaneously.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17887.88
  • base_dd_max:17887.88
  • base_dd_mult:1.00
 
Storms Reckoning 904 1.7% 53.5 5.61sec 5048 0 Direct 53.1 4100 8454 5080 22.5%  

Stats details: storms_reckoning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.47 53.14 0.00 0.00 0.0000 0.0000 269953.38 269953.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.17 77.48% 4099.55 3761 4557 4099.75 3973 4247 168794 168794 0.00
crit 11.97 22.52% 8453.68 7747 9388 8456.12 8130 8975 101160 101160 0.00
 
 

Action details: storms_reckoning

Static Values
  • id:300917
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:15.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:300917
  • name:Storms Reckoning
  • school:nature
  • tooltip:
  • description:{$@spelldesc300913=Your spells have a chance to conjure a typhoon that travels towards enemies dealing {$300917s1=0} Nature damage and grant you $300919s~1 Haste for {$300919d=15 seconds}, up to ${$300919s*{$300919u=4}} Haste. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3473.28
  • base_dd_max:3473.28
  • base_dd_mult:1.00
 
Streaking Star 7075 12.9% 98.0 2.86sec 21437 0 Direct 98.0 17349 35747 21435 22.2%  

Stats details: streaking_star

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.01 98.01 0.00 0.00 0.0000 0.0000 2100916.25 2100916.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.23 77.78% 17349.26 15764 19102 17349.12 16748 18267 1322512 1322512 0.00
crit 21.78 22.22% 35747.41 32473 39351 35749.29 34413 37774 778405 778405 0.00
 
 

Action details: streaking_star

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3337 6.1% 17.6 17.01sec 56597 58618 Direct 17.6 4250 8739 5252 22.3%  
Periodic 236.9 3088 6364 3815 22.2% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.60 17.60 236.93 236.93 0.9656 1.2491 996146.39 996146.39 0.00 3183.25 58617.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.67 77.68% 4250.22 3446 5197 4250.74 3935 4668 58110 58110 0.00
crit 3.93 22.32% 8738.53 7098 10707 8604.67 0 10707 34331 34331 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.4 77.83% 3087.77 11 3768 3088.72 3000 3190 569378 569378 0.00
crit 52.5 22.17% 6364.18 178 7762 6365.92 6097 6889 334327 334327 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Undulating Tides 1793 3.3% 53.5 5.60sec 9995 0 Direct 53.3 8126 16728 10036 22.2%  

Stats details: undulating_tides

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.54 53.33 0.00 0.00 0.0000 0.0000 535150.10 535150.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.50 77.82% 8126.36 7449 9027 8126.61 7851 8543 337263 337263 0.00
crit 11.83 22.18% 16727.71 15345 18595 16728.41 15758 17729 197887 197887 0.00
 
 

Action details: undulating_tides

Static Values
  • id:303389
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303389
  • name:Undulating Tides
  • school:frost
  • tooltip:
  • description:{$@spelldesc303008=Your damaging spells and abilities have a chance to crash a wave upon your target for {$s1=1870} Frost damage. When your health drops below {$s2=50}%, gain a shield absorbing {$s3=14665} damage within {$303390d=8 seconds}. When this occurs, Undulating Tides cannot trigger again for {$s4=45} sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6879.00
  • base_dd_max:6879.00
  • base_dd_mult:1.00
 
pet - guardian_of_azeroth 12512 / 2544
Azerite Spike 11150 4.1% 61.5 3.45sec 10881 11349 Direct 61.5 8899 17797 10881 22.3%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.48 61.48 0.00 0.00 0.9588 0.0000 669011.68 669011.68 0.00 11349.38 11349.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.79 77.73% 8899.49 8233 9070 8899.56 8733 9010 425295 425295 0.00
crit 13.69 22.27% 17797.36 16466 18139 17797.16 17362 18091 243716 243716 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295856
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295856
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:Strike your target with a shard of Azerite, dealing {$s1=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7602.61
  • base_dd_max:7602.61
  • base_dd_mult:1.00
 
Azerite Volley 1361 0.5% 6.0 39.29sec 13615 0 Direct 6.0 11159 22318 13612 22.0%  

Stats details: azerite_volley

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 81687.45 81687.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.68 77.99% 11158.68 10805 11336 11159.98 10871 11336 52218 52218 0.00
crit 1.32 22.01% 22317.82 21610 22672 17337.26 0 22672 29469 29469 0.00
 
 

Action details: azerite_volley

Static Values
  • id:303351
  • school:flamestrike
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303351
  • name:Azerite Volley
  • school:flamestrike
  • tooltip:
  • description:{$@spelldesc295841=Every $303347t1 sec, the Guardian of Azeroth will launch of volley of Azerite Spikes at the target area, dealing {$s1=2287} damage to all enemies near its target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9502.90
  • base_dd_max:9502.90
  • base_dd_mult:1.00
 
Simple Action Stats Execute Interval
leviathans
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:leviathans
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.73sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.58sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8394 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Greater Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:298837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:leviathans
  • harmful:false
  • if_expr:
 
Well Fed (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:297039
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:leviathans
  • harmful:false
  • if_expr:
 
Guardian of Azeroth 2.0 180.47sec

Stats details: guardian_of_azeroth

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9780 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: guardian_of_azeroth

Static Values
  • id:295840
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
Spelldata
  • id:295840
  • name:Guardian of Azeroth
  • school:physical
  • tooltip:
  • description:Call upon Azeroth to summon a Guardian of Azeroth for {$300091d=30 seconds} who impales your target with spikes of Azerite every 2 sec that deal ${$295834m1*(1+$@versadmg)} Fire damage.$?a295841[ Every $303347t1 sec, the Guardian launches a volley of Azerite Spikes at its target, dealing {$295841s1=2287} Fire damage to all nearby enemies.][]$?a295843[ Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.][]
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Potion of Unbridled Fury (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:300714
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.6 57.0 41.7sec 4.7sec 93.60% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.11%
  • arcanic_pulsar_2:10.93%
  • arcanic_pulsar_3:12.13%
  • arcanic_pulsar_4:11.43%
  • arcanic_pulsar_5:12.49%
  • arcanic_pulsar_6:10.37%
  • arcanic_pulsar_7:11.83%
  • arcanic_pulsar_8:13.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.8sec 182.8sec 8.13% 12.48% 0.0(0.0) 2.0

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.56% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 7.8 0.0 40.3sec 40.3sec 26.89% 34.00% 0.0(0.0) 7.6

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Greater Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_greater_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:360.00

Stack Uptimes

  • greater_flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298837
  • name:Greater Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=360} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Guardian of Azeroth 2.0 59.5 180.7sec 3.5sec 19.45% 0.00% 51.5(51.5) 0.0

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_guardian_of_azeroth
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • guardian_of_azeroth_1:0.79%
  • guardian_of_azeroth_2:0.71%
  • guardian_of_azeroth_3:0.68%
  • guardian_of_azeroth_4:0.63%
  • guardian_of_azeroth_5:16.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295855
  • name:Guardian of Azeroth
  • tooltip:Haste increased by {$s1=2}%.
  • description:{$@spelldesc295843=Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.}
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Highborne Compendium of Storms 2.8 50.6 96.1sec 5.5sec 97.43% 0.00% 42.9(42.9) 1.8

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_highborne_compendium_of_storms
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Highborne Compendium of Storms

Stat Buff details

  • stat:haste_rating
  • amount:64.39

Stack Uptimes

  • highborne_compendium_of_storms_1:4.94%
  • highborne_compendium_of_storms_2:4.62%
  • highborne_compendium_of_storms_3:4.07%
  • highborne_compendium_of_storms_4:83.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:300919
  • name:Highborne Compendium of Storms
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc300913=Your spells have a chance to conjure a typhoon that travels towards enemies dealing {$300917s1=0} Nature damage and grant you $300919s~1 Haste for {$300919d=15 seconds}, up to ${$300919s*{$300919u=4}} Haste. }
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Lifeblood 108.6 0.0 150.3sec 2.7sec 98.49% 0.00% 102.6(110.9) 0.0

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_lifeblood
  • max_stacks:4
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:229.17

Stack Uptimes

  • lifeblood_1:1.17%
  • lifeblood_2:1.19%
  • lifeblood_3:1.89%
  • lifeblood_4:94.25%

Trigger Attempt Success

  • trigger_pct:92.31%

Spelldata details

  • id:295137
  • name:Lifeblood
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by ${$w1+$w2+$w3}.
  • description:{$@spelldesc295078=Every {$s4=18}-{$s1=25} sec, a Lifeblood Shard erupts from the nearby ground for {$295114d=12 seconds}.$?!s295186&a295078[ $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within ${$m2*(1+($295160m1/100))} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.][]}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 37.2 48.2 8.1sec 3.5sec 81.21% 99.70% 2.2(2.2) 0.0

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.03%
  • lunar_empowerment_2:30.19%
  • lunar_empowerment_3:14.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (mechdowels_big_mech) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_mechdowels_big_mech
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:93.00

Stack Uptimes

  • mechdowels_big_mech_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297039
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=93} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overclocking Bit Band 17.8 0.0 17.2sec 17.3sec 87.00% 0.00% 0.0(0.0) 16.9

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_overclocking_bit_band
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:160.00

Stack Uptimes

  • overclocking_bit_band_1:87.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:301886
  • name:Overclocking Bit Band
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc300126=...then you gain {$s1=0} Haste for {$s2=15} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.7 3.9 63.3sec 32.0sec 50.63% 0.00% 3.9(54.6) 0.0

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.42%
  • overwhelming_power_2:1.46%
  • overwhelming_power_3:1.51%
  • overwhelming_power_4:1.55%
  • overwhelming_power_5:1.59%
  • overwhelming_power_6:1.64%
  • overwhelming_power_7:1.69%
  • overwhelming_power_8:1.74%
  • overwhelming_power_9:1.80%
  • overwhelming_power_10:1.85%
  • overwhelming_power_11:1.91%
  • overwhelming_power_12:1.97%
  • overwhelming_power_13:2.02%
  • overwhelming_power_14:2.09%
  • overwhelming_power_15:2.16%
  • overwhelming_power_16:2.22%
  • overwhelming_power_17:2.29%
  • overwhelming_power_18:2.37%
  • overwhelming_power_19:2.45%
  • overwhelming_power_20:2.53%
  • overwhelming_power_21:2.61%
  • overwhelming_power_22:2.69%
  • overwhelming_power_23:2.78%
  • overwhelming_power_24:2.86%
  • overwhelming_power_25:1.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Unbridled Fury 2.0 0.0 188.3sec 0.0sec 39.88% 0.00% 0.0(0.0) 1.9

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_potion_of_unbridled_fury
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • potion_of_unbridled_fury_1:39.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:300714
  • name:Potion of Unbridled Fury
  • tooltip:Chance to deal an extra {$300717s1=3600} Fire damage to your current target.
  • description:Fill yourself with unbridled energy, giving your offensive spells and attacks a chance to do an additional {$300717s1=3600} Fire damage to your target. Lasts {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Prodigy's Potency 1.0 43.9 0.0sec 6.6sec 98.25% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_prodigys_potency
  • max_stacks:999
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prodigys_potency_1:1.51%
  • prodigys_potency_2:1.46%
  • prodigys_potency_3:1.50%
  • prodigys_potency_4:1.58%
  • prodigys_potency_5:1.65%
  • prodigys_potency_6:1.89%
  • prodigys_potency_7:2.00%
  • prodigys_potency_8:2.14%
  • prodigys_potency_9:2.26%
  • prodigys_potency_10:2.37%
  • prodigys_potency_11:2.44%
  • prodigys_potency_12:2.47%
  • prodigys_potency_13:2.47%
  • prodigys_potency_14:2.45%
  • prodigys_potency_15:2.52%
  • prodigys_potency_16:2.45%
  • prodigys_potency_17:2.52%
  • prodigys_potency_18:2.45%
  • prodigys_potency_19:2.47%
  • prodigys_potency_20:2.57%
  • prodigys_potency_21:2.34%
  • prodigys_potency_22:2.43%
  • prodigys_potency_23:2.34%
  • prodigys_potency_24:2.27%
  • prodigys_potency_25:2.37%
  • prodigys_potency_26:2.30%
  • prodigys_potency_27:2.22%
  • prodigys_potency_28:2.25%
  • prodigys_potency_29:2.17%
  • prodigys_potency_30:2.09%
  • prodigys_potency_31:2.23%
  • prodigys_potency_32:2.12%
  • prodigys_potency_33:2.25%
  • prodigys_potency_34:2.16%
  • prodigys_potency_35:2.05%
  • prodigys_potency_36:2.02%
  • prodigys_potency_37:1.96%
  • prodigys_potency_38:1.86%
  • prodigys_potency_39:1.78%
  • prodigys_potency_40:1.71%
  • prodigys_potency_41:1.69%
  • prodigys_potency_42:1.55%
  • prodigys_potency_43:1.37%
  • prodigys_potency_44:1.22%
  • prodigys_potency_45:1.06%
  • prodigys_potency_46:0.95%
  • prodigys_potency_47:0.84%
  • prodigys_potency_48:0.69%
  • prodigys_potency_49:0.62%
  • prodigys_potency_50:0.48%
  • prodigys_potency_51:0.40%
  • prodigys_potency_52:0.32%
  • prodigys_potency_53:0.28%
  • prodigys_potency_54:0.22%
  • prodigys_potency_55:0.17%
  • prodigys_potency_56:0.13%
  • prodigys_potency_57:0.11%
  • prodigys_potency_58:0.08%
  • prodigys_potency_59:0.06%
  • prodigys_potency_60:0.06%
  • prodigys_potency_61:0.04%
  • prodigys_potency_62:0.02%
  • prodigys_potency_63:0.03%
  • prodigys_potency_64:0.03%
  • prodigys_potency_65:0.04%
  • prodigys_potency_66:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:303017
  • name:Prodigy's Potency
  • tooltip:$w1 damage and healing stored.
  • description:
  • max_stacks:999
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
Solar Empowerment 28.5 52.7 10.5sec 3.7sec 83.97% 77.29% 0.2(0.2) 0.0

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.69%
  • solar_empowerment_2:37.96%
  • solar_empowerment_3:15.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 49.5 20.2sec 4.6sec 97.95% 96.89% 19.4(19.4) 11.4

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:13.49%
  • starlord_2:21.46%
  • starlord_3:63.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Strife 2.1 52.3 109.4sec 5.4sec 97.81% 0.00% 39.2(39.2) 1.1

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_strife
  • max_stacks:8
  • duration:14.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:53.82

Stack Uptimes

  • strife_1:3.81%
  • strife_2:3.75%
  • strife_3:3.59%
  • strife_4:3.55%
  • strife_5:3.39%
  • strife_6:3.27%
  • strife_7:3.13%
  • strife_8:73.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:304056
  • name:Strife
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc304081=Your spells and abilities have a chance to increase your Versatility by {$s1=0} for {$304056d=8 seconds}, stacking up to {$304056u=5} times. Being the vicitim of a loss of control or movement impairing effect also grants a stack of Strife.}
  • max_stacks:5
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 61.4sec 46.0sec 23.50% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.50%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
unempowered_solar_wrath 23.5 12.5sec
unempowered_lunar_strike 0.2 85.1sec
wasted_streaking_star 0.0 0.0sec
arcanic_pulsar_proc 6.7 42.8sec

Resources

Resource Usage Type Count Total Average RPE APR
leviathans
starsurge Astral Power 64.8 2593.0 40.0 40.0 1634.4
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 102.73 821.79 (32.16%) 8.00 0.08 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.13%) 40.00 0.00 0.00%
sunfire Astral Power 17.60 52.80 (2.07%) 3.00 0.00 0.00%
shooting_stars Astral Power 47.37 189.47 (7.41%) 4.00 0.00 0.00%
moonfire Astral Power 14.17 42.52 (1.66%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.76 102.06 (3.99%) 8.00 0.00 0.00%
lunar_strike Astral Power 82.20 986.32 (38.60%) 12.00 0.06 0.01%
natures_balance Astral Power 399.02 199.51 (7.81%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.74 80.87 (3.16%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.55 8.68
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.00 0.50 46.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data leviathans Fight Length
Count 1192
Mean 298.89
Minimum 240.09
Maximum 359.91
Spread ( max - min ) 119.82
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data leviathans Damage Per Second
Count 1192
Mean 54789.24
Minimum 49981.78
Maximum 61000.94
Spread ( max - min ) 11019.15
Range [ ( max - min ) / 2 * 100% ] 10.06%
Standard Deviation 1826.4705
5th Percentile 51893.49
95th Percentile 57891.43
( 95th Percentile - 5th Percentile ) 5997.94
Mean Distribution
Standard Deviation 52.9023
95.00% Confidence Intervall ( 54685.55 - 54892.93 )
Normalized 95.00% Confidence Intervall ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4270
0.1 Scale Factor Error with Delta=300 28478
0.05 Scale Factor Error with Delta=300 113912
0.01 Scale Factor Error with Delta=300 2847797
Priority Target DPS
Sample Data leviathans Priority Target Damage Per Second
Count 1192
Mean 54789.24
Minimum 49981.78
Maximum 61000.94
Spread ( max - min ) 11019.15
Range [ ( max - min ) / 2 * 100% ] 10.06%
Standard Deviation 1826.4705
5th Percentile 51893.49
95th Percentile 57891.43
( 95th Percentile - 5th Percentile ) 5997.94
Mean Distribution
Standard Deviation 52.9023
95.00% Confidence Intervall ( 54685.55 - 54892.93 )
Normalized 95.00% Confidence Intervall ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4270
0.1 Scale Factor Error with Delta=300 28478
0.05 Scale Factor Error with Delta=300 113912
0.01 Scale Factor Error with Delta=300 2847797
DPS(e)
Sample Data leviathans Damage Per Second (Effective)
Count 1192
Mean 54789.24
Minimum 49981.78
Maximum 61000.94
Spread ( max - min ) 11019.15
Range [ ( max - min ) / 2 * 100% ] 10.06%
Damage
Sample Data leviathans Damage
Count 1192
Mean 15579851.82
Minimum 12428240.87
Maximum 19059381.92
Spread ( max - min ) 6631141.05
Range [ ( max - min ) / 2 * 100% ] 21.28%
DTPS
Sample Data leviathans Damage Taken Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data leviathans Healing Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data leviathans Healing Per Second (Effective)
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data leviathans Heal
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data leviathans Healing Taken Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data leviathans Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data leviathansTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data leviathans Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
Azerite variables
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
Starfall v Starsurge target cutoff
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6
F 2.00 berserking,if=buff.ca_inc.up
0.00 use_item,name=azsharas_font_of_power,if=equipped.169314&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
CDs
G 2.00 guardian_of_azeroth,if=(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
0.00 use_item,name=tidestorm_codex,if=equipped.165576
0.00 use_item,name=pocketsized_computation_device,if=equipped.167555&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
0.00 use_item,name=shiver_venom_relic,if=equipped.168905&cooldown.ca_inc.remains>30&!buff.ca_inc.up
0.00 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(!talent.stellar_flare.enabled|dot.stellar_flare.remains>10)&!buff.ca_inc.up&(astral_power<25|cooldown.ca_inc.remains>30)
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 focused_azerite_beam
0.00 thorns
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(buff.memory_of_lucid_dreams.up|ap_check)&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)
H 2.00 celestial_alignment,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 2.89 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
Spenders
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 64.82 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 2.74 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 2.72 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 14.56 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
DoTs
N 11.45 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.76 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
Generators
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 82.59 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 101.98 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.31 sunfire
Fallthru for movement

Sample Sequence

0123456789ACDJNMOGHFJQPJQPQPJQPJQMQNQPQPJOJQPJPPPQQQQQJMJQPQPQLPIJJPPJOQPQJQMPQPQQQQIJJNPPJQPQMOPQQQJQPQIJQJLPPJPMPJQPOQPQQQQJJPQJMNQPPJQPQQQOQQJQJQPJQKNPPJPQQJPQPQJMOPPJNQPJQPQPQQMPJJQPOJQLPPJPPQQMQQQJJGPPQHEFJNOQPJQMQPQRIJQPJQPJQPJQPQPJQPOLPMIJQPJQPJQPJQPPQQPMNOJJQPQPPJQPJQPJMQPNPJQOJQPPJQPQP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask leviathans 58.0/100: 58% astral_power
Pre precombat 1 food leviathans 58.0/100: 58% astral_power
Pre precombat 2 augmentation leviathans 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power potion_of_unbridled_fury
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power lunar_empowerment, potion_of_unbridled_fury
0:01.207 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, potion_of_unbridled_fury
0:02.111 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, lifeblood(2), arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms, potion_of_unbridled_fury
0:02.992 default O stellar_flare Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, lifeblood(2), arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms, potion_of_unbridled_fury
0:03.871 default G guardian_of_azeroth Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, lifeblood(2), arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(2), strife, potion_of_unbridled_fury
0:04.745 default H celestial_alignment Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, lifeblood(2), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(2), strife, potion_of_unbridled_fury
0:05.506 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, lifeblood(2), guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(2), strife, potion_of_unbridled_fury
0:05.506 default J starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, lifeblood(2), guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(2), strife, potion_of_unbridled_fury
0:06.263 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(2), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency, strife, potion_of_unbridled_fury
0:07.017 default P lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(3), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency, strife(2), potion_of_unbridled_fury
0:07.826 default J starsurge Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency, strife(2), potion_of_unbridled_fury
0:08.581 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency, strife(2), potion_of_unbridled_fury
0:09.335 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency, strife(2), potion_of_unbridled_fury
0:10.090 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency, strife(3), potion_of_unbridled_fury
0:10.844 default P lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:11.598 default J starsurge Fluffy_Pillow 71.5/100: 72% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:12.353 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(3), potion_of_unbridled_fury
0:13.107 default P lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(3), potion_of_unbridled_fury
0:13.862 default J starsurge Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(4), potion_of_unbridled_fury
0:14.617 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(4), potion_of_unbridled_fury
0:15.370 default M sunfire Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(4), potion_of_unbridled_fury
0:16.125 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(4), potion_of_unbridled_fury
0:16.880 default N moonfire Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(3), strife(5), potion_of_unbridled_fury
0:17.634 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(5), potion_of_unbridled_fury
0:18.387 default P lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(5), potion_of_unbridled_fury
0:19.206 default Q solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(5), potion_of_unbridled_fury
0:19.959 default P lunar_strike Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(6), potion_of_unbridled_fury
0:20.780 default J starsurge Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(6), potion_of_unbridled_fury
0:21.534 default O stellar_flare Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(6), potion_of_unbridled_fury
0:22.291 default J starsurge Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(6), potion_of_unbridled_fury
0:23.045 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(7), potion_of_unbridled_fury
0:23.799 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(7), potion_of_unbridled_fury
0:24.642 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(7), potion_of_unbridled_fury
0:25.397 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(7), potion_of_unbridled_fury
0:26.340 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(8), potion_of_unbridled_fury
0:27.284 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(8), potion_of_unbridled_fury
0:28.230 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(8), potion_of_unbridled_fury
0:28.984 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(8), potion_of_unbridled_fury
0:29.738 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(8), potion_of_unbridled_fury
0:30.492 default Q solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), strife(8), potion_of_unbridled_fury
0:31.248 default Q solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), strife(8), potion_of_unbridled_fury
0:32.002 default J starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(5), strife(8), potion_of_unbridled_fury
0:32.755 default M sunfire Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(25), strife(8), potion_of_unbridled_fury
0:33.511 default J starsurge Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(24), strife(8), potion_of_unbridled_fury
0:34.266 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(23), strife(8), potion_of_unbridled_fury
0:35.020 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(22), strife(8), potion_of_unbridled_fury
0:35.857 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(22), strife(8), potion_of_unbridled_fury
0:36.614 default P lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(21), strife(8), potion_of_unbridled_fury
0:37.455 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(20), strife(8), potion_of_unbridled_fury
0:38.209 default L moonfire Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(19), strife(8), potion_of_unbridled_fury
0:38.963 default P lunar_strike Fluffy_Pillow 81.5/100: 82% astral_power bloodlust, lifeblood(4), arcanic_pulsar, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(19), strife(8), potion_of_unbridled_fury
0:39.934 default I cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, lifeblood(4), arcanic_pulsar, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(18), strife(8), potion_of_unbridled_fury
0:39.934 default J starsurge Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, lifeblood(4), arcanic_pulsar, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(18), strife(8), potion_of_unbridled_fury
0:40.768 default J starsurge Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(7), overwhelming_power(17), strife(8), potion_of_unbridled_fury
0:41.582 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(7), overwhelming_power(16), strife(8), potion_of_unbridled_fury
0:42.896 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(7), overwhelming_power(15), strife(8), potion_of_unbridled_fury
0:44.214 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(7), overwhelming_power(13), strife(8), potion_of_unbridled_fury
0:45.254 default O stellar_flare Fluffy_Pillow 2.0/100: 2% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), overwhelming_power(12), strife(8), potion_of_unbridled_fury
0:46.270 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), overwhelming_power(11), strife(8), potion_of_unbridled_fury
0:47.136 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), overwhelming_power(10), strife(8), potion_of_unbridled_fury
0:48.439 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), overwhelming_power(9), strife(8), potion_of_unbridled_fury
0:49.327 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), overwhelming_power(8), strife(8), potion_of_unbridled_fury
0:50.375 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), overwhelming_power(7), strife(8), potion_of_unbridled_fury
0:51.253 default M sunfire Fluffy_Pillow 10.0/100: 10% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), overwhelming_power(6), strife(8), potion_of_unbridled_fury
0:52.288 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), overwhelming_power(5), strife(8), potion_of_unbridled_fury
0:53.613 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(9), overwhelming_power(4), strife(8), potion_of_unbridled_fury
0:54.501 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(9), overwhelming_power(3), strife(8), potion_of_unbridled_fury
0:55.834 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(9), overwhelming_power(2), strife(8), potion_of_unbridled_fury
0:56.727 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power lifeblood(4), arcanic_pulsar(5), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(9), overwhelming_power(25), strife(8), potion_of_unbridled_fury
0:57.701 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power lifeblood(4), arcanic_pulsar(5), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(9), overwhelming_power(24), strife(8), potion_of_unbridled_fury
0:58.678 default Q solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power lifeblood(4), arcanic_pulsar(5), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(23), strife(8)
0:59.659 default I cancel_buff Fluffy_Pillow 90.5/100: 91% astral_power lifeblood(4), arcanic_pulsar(5), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(22), strife(8)
0:59.659 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power lifeblood(4), arcanic_pulsar(5), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(22), strife(8)
1:00.731 default J starsurge Fluffy_Pillow 51.0/100: 51% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(21), strife(8)
1:01.774 default N moonfire Fluffy_Pillow 12.0/100: 12% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(20), strife(8)
1:02.791 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(19), strife(8)
1:04.090 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(17), strife(8)
1:05.400 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(2), starlord(2), highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(16), strife(8)
1:06.449 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(15), strife(8)
1:07.319 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(14), strife(8)
1:08.603 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(13), strife(8)
1:09.465 default M sunfire Fluffy_Pillow 36.0/100: 36% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(25), strife(8)
1:10.440 default O stellar_flare Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(24), strife(8)
1:11.416 default P lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(23), strife(8)
1:12.664 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(22), strife(8)
1:13.501 default Q solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(21), strife(8)
1:14.488 default Q solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(20), strife(8)
1:15.477 default J starsurge Fluffy_Pillow 91.0/100: 91% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(19), strife(8)
1:16.471 default Q solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(18), strife(8)
1:17.225 default P lunar_strike Fluffy_Pillow 72.0/100: 72% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(24), strife(8)
1:18.305 default Q solar_wrath Fluffy_Pillow 85.0/100: 85% astral_power lifeblood(4), celestial_alignment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(23), strife(8)
1:19.060 default I cancel_buff Fluffy_Pillow 93.5/100: 94% astral_power lifeblood(4), celestial_alignment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(10), overwhelming_power(22), strife(8)
1:19.060 default J starsurge Fluffy_Pillow 93.5/100: 94% astral_power lifeblood(4), celestial_alignment, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(10), overwhelming_power(22), strife(8)
1:19.991 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(10), overwhelming_power(22), strife(8)
1:20.760 default J starsurge Fluffy_Pillow 62.5/100: 63% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(10), overwhelming_power(21), strife(8)
1:21.669 default L moonfire Fluffy_Pillow 23.0/100: 23% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(10), overwhelming_power(20), strife(8)
1:22.553 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(10), overwhelming_power(19), strife(8)
1:23.875 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(10), overwhelming_power(18), strife(8)
1:25.203 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(2), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(10), overwhelming_power(16), strife(8)
1:26.253 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(10), overwhelming_power(15), strife(8)
1:27.555 default M sunfire Fluffy_Pillow 26.0/100: 26% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms, torrent_of_elements, prodigys_potency(11), overwhelming_power(25), strife(8)
1:28.566 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms, torrent_of_elements, prodigys_potency(11), overwhelming_power(24), strife(8)
1:29.837 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms, torrent_of_elements, prodigys_potency(11), overwhelming_power(23), strife(8)
1:30.840 default Q solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), torrent_of_elements, prodigys_potency(11), overwhelming_power(22), strife(8)
1:31.686 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), torrent_of_elements, prodigys_potency(11), overwhelming_power(21), strife(8)
1:32.960 default O stellar_flare Fluffy_Pillow 24.5/100: 25% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), torrent_of_elements, prodigys_potency(11), overwhelming_power(20), strife(8)
1:33.963 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(11), overwhelming_power(19), strife(8)
1:34.818 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(11), overwhelming_power(18), strife(8)
1:36.104 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(11), overwhelming_power(16), strife(8)
1:36.969 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(11), overwhelming_power(16), strife(8)
1:37.833 default Q solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power lifeblood(4), arcanic_pulsar(4), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(11), overwhelming_power(15), strife(8)
1:38.853 default Q solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power lifeblood(4), arcanic_pulsar(4), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(11), overwhelming_power(14), strife(8)
1:39.876 default J starsurge Fluffy_Pillow 93.5/100: 94% astral_power lifeblood(4), arcanic_pulsar(4), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(11), overwhelming_power(13), strife(8)
1:40.995 default J starsurge Fluffy_Pillow 54.0/100: 54% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(11), overwhelming_power(12), strife(8)
1:42.084 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(12), overwhelming_power(10), strife(8)
1:43.433 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), highborne_compendium_of_storms(3), prodigys_potency(12), overwhelming_power(9), strife(8)
1:44.353 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(12), overwhelming_power(8), strife(8)
1:45.419 default M sunfire Fluffy_Pillow 1.0/100: 1% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(12), overwhelming_power(7), strife(8)
1:46.461 default N moonfire Fluffy_Pillow 4.5/100: 5% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(12), overwhelming_power(6), strife(8)
1:47.505 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(5), strife(8)
1:48.389 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(4), strife(8)
1:49.718 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(3), strife(8)
1:51.052 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(12), overwhelming_power, strife(8)
1:52.106 default Q solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(12), strife(8)
1:53.005 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(12), strife(8)
1:54.354 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(12), strife(8)
1:55.252 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(12), strife(8)
1:56.153 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(12), overwhelming_power(24), strife(8)
1:57.130 default O stellar_flare Fluffy_Pillow 55.0/100: 55% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(12), overwhelming_power(23), strife(8)
1:58.109 default Q solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), overwhelming_power(22), strife(8)
1:59.092 default Q solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), overwhelming_power(21), strife(8)
2:00.081 default J starsurge Fluffy_Pillow 81.0/100: 81% astral_power lifeblood(4), arcanic_pulsar(8), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), overwhelming_power(20), strife(8)
2:01.178 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), overwhelming_power(19), strife(8)
2:01.968 default J starsurge Fluffy_Pillow 62.0/100: 62% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, starlord, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), overwhelming_power(19), strife(8)
2:02.899 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), overwhelming_power(18), strife(8)
2:03.669 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), overwhelming_power(17), strife(8)
2:04.827 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(13), overwhelming_power(16), strife(8)
2:05.724 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(15), strife(8)
2:06.479 default K sunfire Fluffy_Pillow 13.0/100: 13% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(14), strife(8)
2:07.358 default N moonfire Fluffy_Pillow 16.5/100: 17% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(13), strife(8)
2:08.368 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(12), strife(8)
2:09.660 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(11), strife(8)
2:10.960 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(10), strife(8)
2:11.981 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(9), strife(8)
2:13.288 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(7), strife(8)
2:14.166 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(6), strife(8)
2:15.048 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(5), strife(8)
2:16.090 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(4), strife(8)
2:17.419 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(3), strife(8)
2:18.309 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(2), strife(8)
2:19.647 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power, strife(8)
2:20.541 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, highborne_compendium_of_storms(4), prodigys_potency(14), strife(8)
2:21.716 default M sunfire Fluffy_Pillow 9.0/100: 9% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), strife(8)
2:22.836 default O stellar_flare Fluffy_Pillow 13.0/100: 13% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), strife(8)
2:23.955 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), strife(8)
2:25.381 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), strife(8)
2:26.807 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), strife(8)
2:27.927 default N moonfire Fluffy_Pillow 8.5/100: 9% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), strife(8)
2:29.016 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), strife(8)
2:29.941 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), strife(8)
2:31.327 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(16), strife(8)
2:32.416 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(16), strife(8)
2:33.316 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(16), strife(8)
2:34.663 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(16), strife(8)
2:35.561 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(16), strife(8)
2:36.934 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(16), strife(8)
2:37.850 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(16), strife(8)
2:38.766 default M sunfire Fluffy_Pillow 66.5/100: 67% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(16), strife(8)
2:39.843 default P lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(16), strife(8)
2:41.192 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power lifeblood(4), arcanic_pulsar(7), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
2:42.345 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
2:43.465 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
2:44.271 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
2:45.477 default O stellar_flare Fluffy_Pillow 38.0/100: 38% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
2:46.422 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
2:47.369 default Q solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
2:48.152 default L moonfire Fluffy_Pillow 16.0/100: 16% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
2:49.073 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
2:50.421 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
2:51.769 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
2:52.826 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
2:54.173 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
2:55.546 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(18), strife(8)
2:56.463 default Q solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife(8)
2:57.365 default M sunfire Fluffy_Pillow 53.0/100: 53% astral_power lifeblood(4), arcanic_pulsar(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife(8)
2:58.424 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power lifeblood(4), arcanic_pulsar(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife(8)
2:59.483 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power lifeblood(4), arcanic_pulsar(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife(8)
3:00.541 default Q solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power lifeblood(4), arcanic_pulsar(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife(8)
3:01.600 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power lifeblood(4), arcanic_pulsar(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife(8)
3:02.754 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife(8)
3:03.873 default G guardian_of_azeroth Fluffy_Pillow 4.5/100: 5% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife(8)
3:04.962 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife(8)
3:06.349 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power lifeblood(4), guardian_of_azeroth, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife
3:07.707 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power lifeblood(4), guardian_of_azeroth(2), arcanic_pulsar(4), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife
3:08.596 default H celestial_alignment Fluffy_Pillow 43.5/100: 44% astral_power lifeblood(4), guardian_of_azeroth(3), arcanic_pulsar(4), celestial_alignment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife
3:09.489 default E potion Fluffy_Pillow 84.0/100: 84% astral_power lifeblood(4), guardian_of_azeroth(4), arcanic_pulsar(4), celestial_alignment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife
3:09.489 default F berserking Fluffy_Pillow 84.0/100: 84% astral_power lifeblood(4), guardian_of_azeroth(4), arcanic_pulsar(4), celestial_alignment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife, potion_of_unbridled_fury
3:09.489 default J starsurge Fluffy_Pillow 84.0/100: 84% astral_power berserking, lifeblood(4), guardian_of_azeroth(4), arcanic_pulsar(4), celestial_alignment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife, potion_of_unbridled_fury
3:10.285 default N moonfire Fluffy_Pillow 44.5/100: 45% astral_power berserking, lifeblood(4), guardian_of_azeroth(4), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), strife, potion_of_unbridled_fury
3:11.061 default O stellar_flare Fluffy_Pillow 48.0/100: 48% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(24), strife, potion_of_unbridled_fury
3:11.815 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(24), strife, potion_of_unbridled_fury
3:12.569 default P lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(23), strife, potion_of_unbridled_fury
3:13.482 default J starsurge Fluffy_Pillow 77.5/100: 78% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(22), strife, potion_of_unbridled_fury
3:14.236 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(21), strife, potion_of_unbridled_fury
3:14.991 default M sunfire Fluffy_Pillow 46.5/100: 47% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), overwhelming_power(21), strife(2), potion_of_unbridled_fury
3:15.746 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), overwhelming_power(20), strife(2), potion_of_unbridled_fury
3:16.500 default P lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), overwhelming_power(19), strife(2), potion_of_unbridled_fury
3:17.409 default Q solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), overwhelming_power(18), strife(2), potion_of_unbridled_fury
3:18.164 default R sunfire Fluffy_Pillow 88.0/100: 88% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), overwhelming_power(24), strife(3), potion_of_unbridled_fury
3:18.920 default I cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), overwhelming_power(24), strife(3), potion_of_unbridled_fury
3:18.920 default J starsurge Fluffy_Pillow 91.5/100: 92% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), overwhelming_power(24), strife(3), potion_of_unbridled_fury
3:19.686 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), overwhelming_power(23), strife(3), potion_of_unbridled_fury
3:20.441 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), overwhelming_power(22), strife(3), potion_of_unbridled_fury
3:21.393 default J starsurge Fluffy_Pillow 73.0/100: 73% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), overwhelming_power(21), strife(4), potion_of_unbridled_fury
3:22.146 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(22), overwhelming_power(20), strife(4), potion_of_unbridled_fury
3:22.900 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(22), overwhelming_power(20), strife(4), potion_of_unbridled_fury
3:23.923 default J starsurge Fluffy_Pillow 58.5/100: 59% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(22), overwhelming_power(19), strife(4), potion_of_unbridled_fury
3:24.730 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(22), overwhelming_power(18), strife(5), potion_of_unbridled_fury
3:25.485 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(22), overwhelming_power(25), strife(5), potion_of_unbridled_fury
3:26.464 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(22), overwhelming_power(24), strife(5), potion_of_unbridled_fury
3:27.236 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(22), overwhelming_power(23), strife(5), potion_of_unbridled_fury
3:27.991 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(22), overwhelming_power(23), strife(5), potion_of_unbridled_fury
3:28.979 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(22), strife(6), potion_of_unbridled_fury
3:29.758 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(21), strife(6), potion_of_unbridled_fury
3:30.751 default J starsurge Fluffy_Pillow 67.5/100: 68% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(20), strife(6), potion_of_unbridled_fury
3:31.535 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(19), strife(6), potion_of_unbridled_fury
3:32.289 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(18), strife(7), potion_of_unbridled_fury
3:33.292 default O stellar_flare Fluffy_Pillow 49.0/100: 49% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(17), strife(7), potion_of_unbridled_fury
3:34.082 default L moonfire Fluffy_Pillow 61.5/100: 62% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(16), strife(7), potion_of_unbridled_fury
3:34.953 default P lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(16), strife(7), potion_of_unbridled_fury
3:36.229 default M sunfire Fluffy_Pillow 86.0/100: 86% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(14), strife(8), potion_of_unbridled_fury
3:37.239 default I cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(13), strife(8), potion_of_unbridled_fury
3:37.239 default J starsurge Fluffy_Pillow 89.5/100: 90% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(13), strife(8), potion_of_unbridled_fury
3:38.343 default Q solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), overwhelming_power(12), strife(8), potion_of_unbridled_fury
3:39.256 default P lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(24), overwhelming_power(11), strife(8), potion_of_unbridled_fury
3:40.631 default J starsurge Fluffy_Pillow 76.0/100: 76% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(25), overwhelming_power(10), strife(8), potion_of_unbridled_fury
3:41.715 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(25), overwhelming_power(9), strife(8), potion_of_unbridled_fury
3:42.612 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(25), overwhelming_power(8), strife(8), potion_of_unbridled_fury
3:43.959 default J starsurge Fluffy_Pillow 62.0/100: 62% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(26), overwhelming_power(7), strife(8), potion_of_unbridled_fury
3:45.022 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(26), overwhelming_power(5), strife(8), potion_of_unbridled_fury
3:45.921 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(26), overwhelming_power(5), strife(8), potion_of_unbridled_fury
3:47.269 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), overwhelming_power(3), strife(8), potion_of_unbridled_fury
3:48.317 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), overwhelming_power(2), strife(8), potion_of_unbridled_fury
3:49.210 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), overwhelming_power, strife(8), potion_of_unbridled_fury
3:50.551 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:51.900 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:52.800 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:53.699 default P lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:55.049 default M sunfire Fluffy_Pillow 69.5/100: 70% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:56.108 default N moonfire Fluffy_Pillow 73.0/100: 73% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
3:57.168 default O stellar_flare Fluffy_Pillow 77.0/100: 77% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
3:58.226 default J starsurge Fluffy_Pillow 85.5/100: 86% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
3:59.380 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
4:00.498 default Q solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
4:01.424 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
4:02.809 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
4:03.734 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
4:05.119 default P lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
4:06.505 default J starsurge Fluffy_Pillow 71.0/100: 71% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
4:07.594 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
4:08.376 default P lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
4:09.549 default J starsurge Fluffy_Pillow 69.0/100: 69% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8)
4:10.470 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8)
4:11.252 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8)
4:12.425 default J starsurge Fluffy_Pillow 55.0/100: 55% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8)
4:13.346 default M sunfire Fluffy_Pillow 15.5/100: 16% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8)
4:14.405 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8)
4:15.304 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), strife(8)
4:16.652 default N moonfire Fluffy_Pillow 41.0/100: 41% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8)
4:17.709 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8)
4:19.057 default J starsurge Fluffy_Pillow 61.5/100: 62% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment(2), highborne_compendium_of_storms(4), prodigys_potency(30), strife(8)
4:20.232 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8)
4:21.185 default O stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8)
4:22.306 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8)
4:23.426 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power lifeblood(3), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8)
4:24.352 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power lifeblood(3), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8)
4:25.739 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8)
4:27.126 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8)
4:28.215 default Q solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8)
4:29.114 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8)
4:30.459 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8)
4:31.358 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16715 15195 12905
Intellect 1467 -3 12859 11249 9250 (5789)
Spirit 0 0 0 0 0
Health 334300 303900 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 12859 11249 0
Crit 22.17% 20.88% 1143
Haste 24.38% 24.38% 1658
Damage / Heal Versatility 3.13% 3.13% 266
ManaReg per Second 2396 640 0
Attack Power 13373 11699 0
Mastery 37.17% 37.17% 1162
Armor 2828 2828 2828
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 435.00
Local Head Shroud of Unmooring Whispers
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
azerite powers: { Streaking Stars, Arcanic Pulsar, Overwhelming Power }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Shoulderpads of Frothing Rage
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
azerite powers: { Streaking Stars, Loyal to the End, Heed My Call }
Local Chest Tunic of the Sycophant
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
azerite powers: { Streaking Stars, Undulating Tides, Gutripper }
Local Waist Vim's Scalecrusher Clasp
ilevel: 425, stats: { 233 Armor, +358 AgiInt, +637 Sta, +102 Crit, +111 Haste }, gems: { +50 Haste }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Akana's Reefstrider Footwraps
ilevel: 425, stats: { 285 Armor, +358 AgiInt, +637 Sta, +102 Mastery, +111 Haste }, gems: { +50 Haste }
Local Wrists Ori's Tidal Wristwraps
ilevel: 425, stats: { 181 Armor, +268 AgiInt, +478 Sta, +87 Vers, +73 Haste }, gems: { +50 Haste }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Overclocking Bit Band
ilevel: 415, stats: { +430 Sta, +388 Haste, +97 Mastery }, enchant: { +60 Crit }
Local Finger2 Logic Loop of Recursion
ilevel: 415, stats: { +430 Sta, +361 Crit, +124 Haste }, enchant: { +60 Crit }
Local Trinket1 Leviathan's Lure
ilevel: 445, stats: { +546 Int }
Local Trinket2 Highborne Compendium of Storms
ilevel: 400, stats: { +359 Int }
Local Back Shirakess Drape
ilevel: 425, stats: { 122 Armor, +268 StrAgiInt, +478 Sta, +83 Haste, +77 Mastery }, gems: { +50 Haste }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="leviathans"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
professions=engineering=100/jewelcrafting=100
talents=1000231
azerite_essences=14:3:1/32:3:0/4:3:0

# Default consumables
potion=unbridled_fury
flask=greater_flask_of_endless_fathoms
food=mechdowels_big_mech
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Azerite variables
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
# Starfall v Starsurge target cutoff
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6
actions+=/berserking,if=buff.ca_inc.up
# CDs
actions+=/use_item,name=azsharas_font_of_power,if=equipped.169314&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/guardian_of_azeroth,if=(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_item,name=pocketsized_computation_device,if=equipped.167555&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/use_item,name=shiver_venom_relic,if=equipped.168905&cooldown.ca_inc.remains>30&!buff.ca_inc.up
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(!talent.stellar_flare.enabled|dot.stellar_flare.remains>10)&!buff.ca_inc.up&(astral_power<25|cooldown.ca_inc.remains>30)
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/focused_azerite_beam
actions+=/thorns
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(buff.memory_of_lucid_dreams.up|ap_check)&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)
actions+=/celestial_alignment,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
# Spenders
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
# DoTs
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
# Generators
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
# Fallthru for movement
actions+=/sunfire

head=shroud_of_unmooring_whispers,id=168349,ilevel=450,azerite_powers=122/200/30
neck=heart_of_azeroth,id=158075,ilevel=463,azerite_level=65
shoulders=shoulderpads_of_frothing_rage,id=168348,ilevel=450,azerite_powers=122/576/22
back=shirakess_drape,id=169486,ilevel=425,gems=50haste
chest=tunic_of_the_sycophant,id=168350,ilevel=450,azerite_powers=122/575/31
wrists=oris_tidal_wristwraps,id=170305,ilevel=425,gems=50haste
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=vims_scalecrusher_clasp,id=170368,ilevel=425,gems=50haste
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=akanas_reefstrider_footwraps,id=170141,ilevel=425,gems=50haste
finger1=overclocking_bit_band,id=169159,ilevel=415,enchant=60crit
finger2=logic_loop_of_recursion,id=169158,ilevel=415,enchant=60crit
trinket1=leviathans_lure,id=169304,ilevel=445
trinket2=highborne_compendium_of_storms,id=169328,ilevel=400
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=434.87
# gear_stamina=12905
# gear_intellect=9250
# gear_crit_rating=1143
# gear_haste_rating=1658
# gear_mastery_rating=805
# gear_versatility_rating=266
# gear_armor=2828

recalibration : 54358 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
54358.0 54358.0 105.8 / 0.195% 6939.3 / 12.8% 5783.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.9 8.8 Astral Power 0.00% 62.8 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator
Professions
  • engineering: 100
  • jewelcrafting: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
recalibration 54358
Azerite Spike 1081 2.0% 18.4 15.88sec 17557 0 Direct 18.4 13896 28604 17573 25.0%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.38 18.36 0.00 0.00 0.0000 0.0000 322620.66 322620.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.77 74.99% 13895.70 12749 15444 13889.35 13298 14719 191302 191302 0.00
crit 4.59 25.01% 28604.25 26263 31815 28402.90 0 31815 131319 131319 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295835
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:90.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295835
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:{$@spelldesc295834=Your spells and abilities have a high chance to impale your target with a spike of Azerite, causing ${$m1*(1+$@versadmg)} Fire damage.$?a295837[ When an Azerite spike deals damage, all damage you deal against that target is increased by {$295838s1=5}% for {$295838d=6 seconds}.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11696.33
  • base_dd_max:11696.33
  • base_dd_mult:1.00
 
Conch Strike 394 0.7% 13.7 20.14sec 8622 0 Direct 13.5 6886 14184 8719 25.1%  

Stats details: conch_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.66 13.51 0.00 0.00 0.0000 0.0000 117806.28 168294.68 30.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.12 74.89% 6886.49 6457 7111 6887.49 6640 7091 69680 99543 30.00
crit 3.39 25.11% 14184.22 13302 14650 13765.23 0 14650 48126 68752 29.12
 
 

Action details: conch_strike

Static Values
  • id:304698
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:304698
  • name:Conch Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc304697=While in Nazjatar or the Eternal Palace, your spells and abilities have a chance to deal Physical damage and increased threat to enemies in a small area around the target. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8462.82
  • base_dd_max:8462.82
  • base_dd_mult:1.00
 
Frost Blast 618 1.1% 13.8 20.40sec 13352 0 Direct 13.8 10566 21769 13355 24.9%  

Stats details: frost_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.85 13.85 0.00 0.00 0.0000 0.0000 184876.58 184876.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.40 75.13% 10565.55 9687 11735 10565.57 10075 11242 109905 109905 0.00
crit 3.44 24.87% 21769.33 19955 24174 21216.61 0 24174 74972 74972 0.00
 
 

Action details: frost_blast

Static Values
  • id:304645
  • school:frost
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:304645
  • name:Frost Blast
  • school:frost
  • tooltip:Slowed.
  • description:{$@spelldesc304640=While in Nazjatar or the Eternal Palace, your spells and abilities have a chance to deal {$304645s1=0} Frost damage to your target, slowing them for {$304645d=6 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8887.35
  • base_dd_max:8887.35
  • base_dd_mult:1.00
 
Gutripper 561 1.0% 39.7 7.26sec 4210 0 Direct 39.7 3330 6856 4210 24.9%  

Stats details: gutripper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.72 39.72 0.00 0.00 0.0000 0.0000 167209.00 238870.00 30.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.81 75.05% 3329.97 3121 3437 3331.03 3261 3403 99274 141820 30.00
crit 9.91 24.95% 6856.10 6429 7080 6858.56 6635 7080 67935 97050 30.00
 
 

Action details: gutripper

Static Values
  • id:269031
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:269031
  • name:Gutripper
  • school:physical
  • tooltip:
  • description:{$@spelldesc266937=Your damaging abilities have a chance to deal {$s1=1112} Physical damage to the target. Gutripper occurs much more often against targets below {$s2=30}% health. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4090.00
  • base_dd_max:4090.00
  • base_dd_mult:1.00
 
Heed My Call 366 (524) 0.7% (1.0%) 9.1 30.39sec 17258 0 Direct 9.1 9643 19847 12056 23.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.08 9.08 0.00 0.00 0.0000 0.0000 109468.61 109468.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.93 76.32% 9642.79 8836 10704 9641.12 9105 10704 66807 66807 0.00
crit 2.15 23.68% 19846.64 18202 22050 17685.81 0 22050 42662 42662 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 158 0.3% 9.1 30.39sec 5198 0 Direct 9.1 4132 8510 5197 24.3%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.08 9.08 0.00 0.00 0.0000 0.0000 47182.89 47182.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.87 75.66% 4131.99 3787 4587 4126.13 0 4587 28379 28379 0.00
crit 2.21 24.34% 8510.00 7801 9450 7457.09 0 9450 18804 18804 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6333 11.7% 84.5 3.44sec 22386 18947 Direct 84.5 17755 36587 22386 24.6%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.49 84.49 0.00 0.00 1.1815 0.0000 1891439.37 1891439.37 0.00 18947.17 18947.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.72 75.41% 17755.01 11800 21883 17761.33 17188 18405 1131297 1131297 0.00
crit 20.78 24.59% 36586.92 22672 45078 36589.93 34484 39555 760142 760142 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3055 5.6% 14.2 21.14sec 64161 68555 Direct 14.2 2951 6074 3727 24.9%  
Periodic 246.5 2765 5696 3485 24.6% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.21 14.21 246.48 246.48 0.9359 1.2045 911923.56 911923.56 0.00 2939.82 68555.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.68 75.14% 2950.67 2392 3620 2950.75 2726 3214 31515 31515 0.00
crit 3.53 24.86% 6074.05 4927 7457 5960.84 0 7457 21456 21456 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 186.0 75.45% 2765.16 22 3370 2765.90 2685 2867 514209 514209 0.00
crit 60.5 24.55% 5696.11 320 6943 5697.58 5471 5986 344743 344743 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Potion of Unbridled Fury 1509 2.7% 82.0 3.03sec 5428 0 Direct 82.0 4303 8866 5429 24.7%  

Stats details: potion_of_unbridled_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.03 82.03 0.00 0.00 0.0000 0.0000 445321.06 445321.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.79 75.33% 4302.72 3924 4754 4302.53 4132 4540 265875 265875 0.00
crit 20.24 24.67% 8866.13 8084 9793 8866.17 8490 9528 179446 179446 0.00
 
 

Action details: potion_of_unbridled_fury

Static Values
  • id:300717
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:300717
  • name:Potion of Unbridled Fury
  • school:fire
  • tooltip:
  • description:Deal {$s1=3600} Fire damage to your current target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3600.00
  • base_dd_max:3600.00
  • base_dd_mult:1.00
 
Shooting Stars 1121 2.1% 49.3 6.04sec 6781 0 Direct 49.3 5378 11075 6782 24.6%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.33 49.33 0.00 0.00 0.0000 0.0000 334539.87 334539.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.18 75.37% 5378.28 4328 6552 5379.83 5078 5706 199967 199967 0.00
crit 12.15 24.63% 11074.53 8917 13497 11078.49 10039 12276 134573 134573 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 4023 (5790) 7.4% (10.7%) 105.7 2.78sec 16354 19303 Direct 106.2 8969 18493 11314 24.6%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.72 106.17 0.00 0.00 0.8472 0.0000 1201226.61 1201226.61 0.00 19303.38 19303.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.03 75.38% 8969.36 7214 10920 8972.09 8711 9363 717773 717773 0.00
crit 26.14 24.62% 18493.29 14861 22495 18503.35 17372 19746 483454 483454 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (_empowered) 1767 3.3% 81.3 3.61sec 6491 0 Direct 81.3 6491 0 6491 0.0%  

Stats details: solar_wrath_empowered

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.28 81.28 0.00 0.00 0.0000 0.0000 527642.40 527642.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.28 100.00% 6490.99 4316 12822 6492.28 5689 7404 527642 527642 0.00
 
 

Action details: solar_wrath_empowered

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5658.40
  • base_dd_max:5658.40
  • base_dd_mult:1.00
 
Starsurge 14362 26.5% 66.6 4.52sec 64345 67159 Direct 66.4 51275 105672 64550 24.4%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.61 66.39 0.00 0.00 0.9581 0.0000 4285937.94 4285937.94 0.00 67158.76 67158.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.19 75.59% 51274.51 41484 62365 51292.85 49569 53490 2573319 2573319 0.00
crit 16.21 24.41% 105672.04 85457 128471 105685.82 97894 114246 1712619 1712619 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1992 3.7% 12.8 23.55sec 46547 49837 Direct 12.8 2554 5255 3224 24.8%  
Periodic 244.4 1796 3701 2265 24.6% 98.5%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.77 12.77 244.36 244.36 0.9340 1.2047 594602.77 594602.77 0.00 1941.21 49836.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.60 75.18% 2554.11 2062 3121 2554.25 2352 2785 24528 24528 0.00
crit 3.17 24.82% 5254.63 4247 6428 5118.91 0 6428 16664 16664 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.3 75.41% 1796.39 46 2184 1796.95 1745 1868 331007 331007 0.00
crit 60.1 24.59% 3700.61 16 4500 3701.63 3562 3875 222404 222404 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Storm of the Eternal 541 1.0% 6.0 120.00sec 26588 0 Direct 6.0 21207 43725 26685 24.3%  

Stats details: storm_of_the_eternal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 5.98 0.00 0.00 0.0000 0.0000 159525.58 159525.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.52 75.66% 21207.17 19498 23621 21208.35 19618 23621 95921 95921 0.00
crit 1.45 24.34% 43724.99 40167 48658 35730.10 0 48658 63605 63605 0.00
 
 

Action details: storm_of_the_eternal

Static Values
  • id:303725
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303725
  • name:Storm of the Eternal
  • school:arcane
  • tooltip:
  • description:{$@spelldesc303733=Storm of the Eternal rises for {$303723d=10 seconds} every {$303722d=120 seconds}, dealing ${{$s1=0}*(1+$@versadmg)} Arcane damage {$303724u=3} times to a random enemy within $303725A1 yds. All Storm of the Eternal effects occur simultaneously.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17887.88
  • base_dd_max:17887.88
  • base_dd_mult:1.00
 
Storms Reckoning 962 1.8% 55.5 5.29sec 5170 0 Direct 55.2 4127 8505 5199 24.5%  

Stats details: storms_reckoning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.55 55.22 0.00 0.00 0.0000 0.0000 287194.52 287194.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.68 75.48% 4127.30 3786 4586 4127.09 3997 4279 172035 172035 0.00
crit 13.54 24.52% 8504.92 7798 9447 8505.99 8065 8953 115160 115160 0.00
 
 

Action details: storms_reckoning

Static Values
  • id:300917
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:15.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:300917
  • name:Storms Reckoning
  • school:nature
  • tooltip:
  • description:{$@spelldesc300913=Your spells have a chance to conjure a typhoon that travels towards enemies dealing {$300917s1=0} Nature damage and grant you $300919s~1 Haste for {$300919d=15 seconds}, up to ${$300919s*{$300919u=4}} Haste. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3473.28
  • base_dd_max:3473.28
  • base_dd_mult:1.00
 
Streaking Star 7537 13.8% 101.6 2.78sec 22015 0 Direct 101.6 17466 35992 22014 24.6%  

Stats details: streaking_star

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.64 101.64 0.00 0.00 0.0000 0.0000 2237641.34 2237641.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.68 75.44% 17466.19 15868 19223 17466.96 16909 18323 1339375 1339375 0.00
crit 24.96 24.56% 35991.73 32688 39599 35993.38 34702 38066 898266 898266 0.00
 
 

Action details: streaking_star

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3396 6.3% 17.9 16.81sec 56706 60621 Direct 17.9 4103 8448 5180 24.8%  
Periodic 245.7 2971 6121 3749 24.7% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.88 17.88 245.71 245.71 0.9354 1.2046 1013758.87 1013758.87 0.00 3241.94 60620.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.45 75.22% 4102.53 3299 4993 4101.90 3870 4410 55170 55170 0.00
crit 4.43 24.78% 8448.36 6795 10286 8362.25 0 10286 37424 37424 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 185.0 75.29% 2970.53 37 3620 2971.54 2883 3078 549565 549565 0.00
crit 60.7 24.71% 6121.05 121 7457 6122.18 5835 6439 371600 371600 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Undulating Tides 1908 3.5% 55.4 5.28sec 10277 0 Direct 55.2 8177 16848 10320 24.7%  

Stats details: undulating_tides

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.45 55.22 0.00 0.00 0.0000 0.0000 569826.22 569826.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.57 75.29% 8176.69 7498 9084 8176.97 7920 8553 339920 339920 0.00
crit 13.65 24.71% 16847.94 15446 18712 16852.33 16075 17912 229906 229906 0.00
 
 

Action details: undulating_tides

Static Values
  • id:303389
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303389
  • name:Undulating Tides
  • school:frost
  • tooltip:
  • description:{$@spelldesc303008=Your damaging spells and abilities have a chance to crash a wave upon your target for {$s1=1870} Frost damage. When your health drops below {$s2=50}%, gain a shield absorbing {$s3=14665} damage within {$303390d=8 seconds}. When this occurs, Undulating Tides cannot trigger again for {$s4=45} sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6879.00
  • base_dd_max:6879.00
  • base_dd_mult:1.00
 
pet - guardian_of_azeroth 13153 / 2674
Azerite Spike 11754 4.4% 63.2 3.36sec 11165 11962 Direct 63.2 8958 17912 11165 24.6%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.17 63.17 0.00 0.00 0.9334 0.0000 705268.67 705268.67 0.00 11961.82 11961.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.60 75.35% 8958.44 8287 9127 8958.34 8755 9061 426383 426383 0.00
crit 15.57 24.65% 17912.48 16575 18254 17912.35 17501 18208 278886 278886 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295856
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295856
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:Strike your target with a shard of Azerite, dealing {$s1=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7602.61
  • base_dd_max:7602.61
  • base_dd_mult:1.00
 
Azerite Volley 1399 0.5% 6.0 39.28sec 13987 0 Direct 6.0 11231 22469 13983 24.5%  

Stats details: azerite_volley

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 83922.94 83922.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.53 75.48% 11231.41 10876 11408 11232.77 10943 11408 50862 50862 0.00
crit 1.47 24.52% 22468.84 21753 22815 18188.66 0 22815 33061 33061 0.00
 
 

Action details: azerite_volley

Static Values
  • id:303351
  • school:flamestrike
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303351
  • name:Azerite Volley
  • school:flamestrike
  • tooltip:
  • description:{$@spelldesc295841=Every $303347t1 sec, the Guardian of Azeroth will launch of volley of Azerite Spikes at the target area, dealing {$s1=2287} damage to all enemies near its target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9502.90
  • base_dd_max:9502.90
  • base_dd_mult:1.00
 
Simple Action Stats Execute Interval
recalibration
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:recalibration
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.48sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.38sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8123 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Greater Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:298837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:recalibration
  • harmful:false
  • if_expr:
 
Well Fed (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:297039
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:recalibration
  • harmful:false
  • if_expr:
 
Guardian of Azeroth 2.0 180.40sec

Stats details: guardian_of_azeroth

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9575 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: guardian_of_azeroth

Static Values
  • id:295840
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
Spelldata
  • id:295840
  • name:Guardian of Azeroth
  • school:physical
  • tooltip:
  • description:Call upon Azeroth to summon a Guardian of Azeroth for {$300091d=30 seconds} who impales your target with spikes of Azerite every 2 sec that deal ${$295834m1*(1+$@versadmg)} Fire damage.$?a295841[ Every $303347t1 sec, the Guardian launches a volley of Azerite Spikes at its target, dealing {$295841s1=2287} Fire damage to all nearby enemies.][]$?a295843[ Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.][]
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Potion of Unbridled Fury (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:300714
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.8 58.5 40.7sec 4.5sec 94.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:10.41%
  • arcanic_pulsar_2:9.81%
  • arcanic_pulsar_3:11.66%
  • arcanic_pulsar_4:12.70%
  • arcanic_pulsar_5:12.61%
  • arcanic_pulsar_6:9.98%
  • arcanic_pulsar_7:10.75%
  • arcanic_pulsar_8:16.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.13% 12.49% 0.0(0.0) 2.0

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.56% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 7.9 0.0 39.7sec 39.7sec 27.27% 34.50% 0.0(0.0) 7.8

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:27.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Greater Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_greater_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:360.00

Stack Uptimes

  • greater_flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298837
  • name:Greater Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=360} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Guardian of Azeroth 2.0 61.2 180.7sec 3.4sec 19.48% 0.00% 53.2(53.2) 0.0

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_guardian_of_azeroth
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • guardian_of_azeroth_1:0.77%
  • guardian_of_azeroth_2:0.68%
  • guardian_of_azeroth_3:0.64%
  • guardian_of_azeroth_4:0.59%
  • guardian_of_azeroth_5:16.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295855
  • name:Guardian of Azeroth
  • tooltip:Haste increased by {$s1=2}%.
  • description:{$@spelldesc295843=Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.}
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Highborne Compendium of Storms 2.5 53.1 104.6sec 5.3sec 97.71% 0.00% 46.2(46.2) 1.5

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_highborne_compendium_of_storms
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Highborne Compendium of Storms

Stat Buff details

  • stat:haste_rating
  • amount:64.39

Stack Uptimes

  • highborne_compendium_of_storms_1:4.12%
  • highborne_compendium_of_storms_2:3.76%
  • highborne_compendium_of_storms_3:3.41%
  • highborne_compendium_of_storms_4:86.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:300919
  • name:Highborne Compendium of Storms
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc300913=Your spells have a chance to conjure a typhoon that travels towards enemies dealing {$300917s1=0} Nature damage and grant you $300919s~1 Haste for {$300919d=15 seconds}, up to ${$300919s*{$300919u=4}} Haste. }
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Lifeblood 108.2 0.0 150.5sec 2.7sec 98.51% 0.00% 102.1(110.5) 0.0

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_lifeblood
  • max_stacks:4
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:229.17

Stack Uptimes

  • lifeblood_1:1.14%
  • lifeblood_2:1.18%
  • lifeblood_3:1.93%
  • lifeblood_4:94.26%

Trigger Attempt Success

  • trigger_pct:92.20%

Spelldata details

  • id:295137
  • name:Lifeblood
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by ${$w1+$w2+$w3}.
  • description:{$@spelldesc295078=Every {$s4=18}-{$s1=25} sec, a Lifeblood Shard erupts from the nearby ground for {$295114d=12 seconds}.$?!s295186&a295078[ $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within ${$m2*(1+($295160m1/100))} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.][]}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 37.5 50.5 8.1sec 3.4sec 81.21% 99.71% 2.4(2.4) 0.0

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.34%
  • lunar_empowerment_2:30.10%
  • lunar_empowerment_3:15.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (mechdowels_big_mech) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_mechdowels_big_mech
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:93.00

Stack Uptimes

  • mechdowels_big_mech_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297039
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=93} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overclocking Bit Band 17.9 0.0 17.2sec 17.2sec 87.38% 0.00% 0.0(0.0) 17.0

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_overclocking_bit_band
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:160.00

Stack Uptimes

  • overclocking_bit_band_1:87.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:301886
  • name:Overclocking Bit Band
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc300126=...then you gain {$s1=0} Haste for {$s2=15} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.7 4.2 62.3sec 30.7sec 51.89% 0.00% 4.2(58.8) 0.0

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.43%
  • overwhelming_power_2:1.47%
  • overwhelming_power_3:1.53%
  • overwhelming_power_4:1.57%
  • overwhelming_power_5:1.62%
  • overwhelming_power_6:1.67%
  • overwhelming_power_7:1.72%
  • overwhelming_power_8:1.77%
  • overwhelming_power_9:1.83%
  • overwhelming_power_10:1.89%
  • overwhelming_power_11:1.95%
  • overwhelming_power_12:2.01%
  • overwhelming_power_13:2.07%
  • overwhelming_power_14:2.14%
  • overwhelming_power_15:2.22%
  • overwhelming_power_16:2.29%
  • overwhelming_power_17:2.36%
  • overwhelming_power_18:2.44%
  • overwhelming_power_19:2.51%
  • overwhelming_power_20:2.59%
  • overwhelming_power_21:2.68%
  • overwhelming_power_22:2.77%
  • overwhelming_power_23:2.87%
  • overwhelming_power_24:2.96%
  • overwhelming_power_25:1.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Unbridled Fury 2.0 0.0 188.1sec 0.0sec 39.88% 0.00% 0.0(0.0) 1.9

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_potion_of_unbridled_fury
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • potion_of_unbridled_fury_1:39.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:300714
  • name:Potion of Unbridled Fury
  • tooltip:Chance to deal an extra {$300717s1=3600} Fire damage to your current target.
  • description:Fill yourself with unbridled energy, giving your offensive spells and attacks a chance to do an additional {$300717s1=3600} Fire damage to your target. Lasts {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Prodigy's Potency 1.0 45.2 0.0sec 6.4sec 98.30% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_prodigys_potency
  • max_stacks:999
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prodigys_potency_1:1.41%
  • prodigys_potency_2:1.41%
  • prodigys_potency_3:1.43%
  • prodigys_potency_4:1.53%
  • prodigys_potency_5:1.59%
  • prodigys_potency_6:1.74%
  • prodigys_potency_7:1.84%
  • prodigys_potency_8:1.98%
  • prodigys_potency_9:2.14%
  • prodigys_potency_10:2.16%
  • prodigys_potency_11:2.32%
  • prodigys_potency_12:2.35%
  • prodigys_potency_13:2.40%
  • prodigys_potency_14:2.44%
  • prodigys_potency_15:2.45%
  • prodigys_potency_16:2.46%
  • prodigys_potency_17:2.43%
  • prodigys_potency_18:2.29%
  • prodigys_potency_19:2.33%
  • prodigys_potency_20:2.40%
  • prodigys_potency_21:2.38%
  • prodigys_potency_22:2.37%
  • prodigys_potency_23:2.28%
  • prodigys_potency_24:2.40%
  • prodigys_potency_25:2.28%
  • prodigys_potency_26:2.17%
  • prodigys_potency_27:2.29%
  • prodigys_potency_28:2.23%
  • prodigys_potency_29:2.15%
  • prodigys_potency_30:2.21%
  • prodigys_potency_31:2.16%
  • prodigys_potency_32:2.12%
  • prodigys_potency_33:2.14%
  • prodigys_potency_34:2.19%
  • prodigys_potency_35:2.05%
  • prodigys_potency_36:2.12%
  • prodigys_potency_37:2.03%
  • prodigys_potency_38:2.00%
  • prodigys_potency_39:1.88%
  • prodigys_potency_40:1.82%
  • prodigys_potency_41:1.69%
  • prodigys_potency_42:1.58%
  • prodigys_potency_43:1.44%
  • prodigys_potency_44:1.32%
  • prodigys_potency_45:1.18%
  • prodigys_potency_46:1.09%
  • prodigys_potency_47:0.96%
  • prodigys_potency_48:0.85%
  • prodigys_potency_49:0.73%
  • prodigys_potency_50:0.61%
  • prodigys_potency_51:0.52%
  • prodigys_potency_52:0.43%
  • prodigys_potency_53:0.39%
  • prodigys_potency_54:0.27%
  • prodigys_potency_55:0.23%
  • prodigys_potency_56:0.18%
  • prodigys_potency_57:0.12%
  • prodigys_potency_58:0.12%
  • prodigys_potency_59:0.09%
  • prodigys_potency_60:0.07%
  • prodigys_potency_61:0.05%
  • prodigys_potency_62:0.04%
  • prodigys_potency_63:0.02%
  • prodigys_potency_64:0.05%
  • prodigys_potency_65:0.03%
  • prodigys_potency_66:0.04%
  • prodigys_potency_67:0.03%
  • prodigys_potency_68:0.03%
  • prodigys_potency_69:0.00%
  • prodigys_potency_70:0.01%
  • prodigys_potency_71:0.01%
  • prodigys_potency_72:0.00%
  • prodigys_potency_73:0.00%
  • prodigys_potency_74:0.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:303017
  • name:Prodigy's Potency
  • tooltip:$w1 damage and healing stored.
  • description:
  • max_stacks:999
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
Recalibrating 9.9 0.0 29.7sec 29.7sec 19.70% 0.00% 0.0(0.0) 9.7

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_recalibrating
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Pocket-Sized Computation Device

Stat Buff details

  • stat:haste_rating
  • amount:-152.83

Stack Uptimes

  • recalibrating_1:19.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:299065
  • name:Recalibrating
  • tooltip:Haste decreased by $w1.
  • description:{$@spelldesc299062=Casting {$s2=12} spells grants you {$s1=301} Haste for {$299064d=12 seconds}, then you lose {$s3=56} Haste for {$299065d=6 seconds} as you recalibrate.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Solar Empowerment 30.2 53.4 9.9sec 3.6sec 83.08% 76.66% 0.2(0.2) 0.0

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.62%
  • solar_empowerment_2:37.47%
  • solar_empowerment_3:15.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.4 51.3 20.1sec 4.5sec 98.12% 97.11% 20.9(20.9) 10.7

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:12.88%
  • starlord_2:20.72%
  • starlord_3:64.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Strife 2.1 52.1 111.7sec 5.5sec 97.77% 0.00% 39.4(39.4) 1.1

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_strife
  • max_stacks:8
  • duration:14.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:53.82

Stack Uptimes

  • strife_1:3.75%
  • strife_2:3.76%
  • strife_3:3.58%
  • strife_4:3.44%
  • strife_5:3.26%
  • strife_6:3.20%
  • strife_7:3.19%
  • strife_8:73.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:304056
  • name:Strife
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc304081=Your spells and abilities have a chance to increase your Versatility by {$s1=0} for {$304056d=8 seconds}, stacking up to {$304056u=5} times. Being the vicitim of a loss of control or movement impairing effect also grants a stack of Strife.}
  • max_stacks:5
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Subroutine: Recalibration 10.3 0.0 29.8sec 29.8sec 40.66% 0.00% 0.0(0.0) 9.9

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_subroutine_recalibration
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Pocket-Sized Computation Device

Stat Buff details

  • stat:haste_rating
  • amount:815.12

Stack Uptimes

  • subroutine_recalibration_1:40.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:299064
  • name:Subroutine: Recalibration
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc299062=Casting {$s2=12} spells grants you {$s1=301} Haste for {$299064d=12 seconds}, then you lose {$s3=56} Haste for {$299065d=6 seconds} as you recalibrate.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Torrent of Elements 4.2 1.1 61.2sec 46.0sec 23.29% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.29%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
unempowered_solar_wrath 25.0 11.7sec
unempowered_lunar_strike 0.2 42.3sec
wasted_streaking_star 0.0 0.0sec
arcanic_pulsar_proc 6.9 41.7sec

Resources

Resource Usage Type Count Total Average RPE APR
recalibration
starsurge Astral Power 66.6 2664.4 40.0 40.0 1608.6
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 106.71 853.60 (32.51%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.05%) 40.00 0.00 0.00%
sunfire Astral Power 17.88 53.63 (2.04%) 3.00 0.00 0.00%
shooting_stars Astral Power 49.33 197.30 (7.51%) 4.00 0.00 0.00%
moonfire Astral Power 14.21 42.64 (1.62%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.78 102.20 (3.89%) 8.00 0.00 0.00%
lunar_strike Astral Power 84.50 1013.95 (38.61%) 12.00 0.07 0.01%
natures_balance Astral Power 399.02 199.51 (7.60%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.92 83.10 (3.16%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.79 8.91
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 18.71 0.00 42.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data recalibration Fight Length
Count 1192
Mean 298.89
Minimum 240.09
Maximum 359.91
Spread ( max - min ) 119.82
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data recalibration Damage Per Second
Count 1192
Mean 54357.99
Minimum 49620.69
Maximum 61839.24
Spread ( max - min ) 12218.55
Range [ ( max - min ) / 2 * 100% ] 11.24%
Standard Deviation 1863.1317
5th Percentile 51561.98
95th Percentile 57546.39
( 95th Percentile - 5th Percentile ) 5984.42
Mean Distribution
Standard Deviation 53.9642
95.00% Confidence Intervall ( 54252.22 - 54463.76 )
Normalized 95.00% Confidence Intervall ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4513
0.1 Scale Factor Error with Delta=300 29633
0.05 Scale Factor Error with Delta=300 118531
0.01 Scale Factor Error with Delta=300 2963267
Priority Target DPS
Sample Data recalibration Priority Target Damage Per Second
Count 1192
Mean 54357.99
Minimum 49620.69
Maximum 61839.24
Spread ( max - min ) 12218.55
Range [ ( max - min ) / 2 * 100% ] 11.24%
Standard Deviation 1863.1317
5th Percentile 51561.98
95th Percentile 57546.39
( 95th Percentile - 5th Percentile ) 5984.42
Mean Distribution
Standard Deviation 53.9642
95.00% Confidence Intervall ( 54252.22 - 54463.76 )
Normalized 95.00% Confidence Intervall ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4513
0.1 Scale Factor Error with Delta=300 29633
0.05 Scale Factor Error with Delta=300 118531
0.01 Scale Factor Error with Delta=300 2963267
DPS(e)
Sample Data recalibration Damage Per Second (Effective)
Count 1192
Mean 54357.99
Minimum 49620.69
Maximum 61839.24
Spread ( max - min ) 12218.55
Range [ ( max - min ) / 2 * 100% ] 11.24%
Damage
Sample Data recalibration Damage
Count 1192
Mean 15409744.14
Minimum 12349918.51
Maximum 18862136.48
Spread ( max - min ) 6512217.97
Range [ ( max - min ) / 2 * 100% ] 21.13%
DTPS
Sample Data recalibration Damage Taken Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data recalibration Healing Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data recalibration Healing Per Second (Effective)
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data recalibration Heal
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data recalibration Healing Taken Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data recalibration Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data recalibrationTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data recalibration Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
Azerite variables
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
Starfall v Starsurge target cutoff
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6
F 2.00 berserking,if=buff.ca_inc.up
0.00 use_item,name=azsharas_font_of_power,if=equipped.169314&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
CDs
G 2.00 guardian_of_azeroth,if=(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
0.00 use_item,name=tidestorm_codex,if=equipped.165576
0.00 use_item,name=pocketsized_computation_device,if=equipped.167555&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
0.00 use_item,name=shiver_venom_relic,if=equipped.168905&cooldown.ca_inc.remains>30&!buff.ca_inc.up
0.00 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(!talent.stellar_flare.enabled|dot.stellar_flare.remains>10)&!buff.ca_inc.up&(astral_power<25|cooldown.ca_inc.remains>30)
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 focused_azerite_beam
0.00 thorns
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(buff.memory_of_lucid_dreams.up|ap_check)&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)
H 2.00 celestial_alignment,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 3.71 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
Spenders
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 66.61 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 3.22 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 2.60 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 14.24 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
DoTs
N 11.61 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.78 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
Generators
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 84.86 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 105.98 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.41 sunfire
Fallthru for movement

Sample Sequence

0123456789ACDJNMOGHFJQJQPQJQPQPJQMQNQPQPJOJQPKJPPPQQQQQJQJQJQPQLPPJJMPOPJQPQJQPPQPQQJJMNQPJQOQPQJKPPPQQIJJNPQJQPPQJMOPQQQPQJJPPNQJPQMQQPQQQOIJQJQPJQKPJNPPQJQPQPPJQOPJMQPJNQPJQPPPQQPJMJQPJOLQPPQJQPQPQQIJJMPGPHEFJQJNOQPQPQJQPMQIJQPJQPJQPJQPQPJNOPMPPQJPJPQQJPQQQJMNPQOQQJQJQPQPJPPPMQJNQPPQQJJOPPQJQPQJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask recalibration 58.0/100: 58% astral_power
Pre precombat 1 food recalibration 58.0/100: 58% astral_power
Pre precombat 2 augmentation recalibration 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power potion_of_unbridled_fury
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power potion_of_unbridled_fury
0:01.209 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, potion_of_unbridled_fury
0:02.113 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, strife, potion_of_unbridled_fury
0:03.001 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, strife, potion_of_unbridled_fury
0:03.890 default G guardian_of_azeroth Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, subroutine_recalibration, strife, potion_of_unbridled_fury
0:04.700 default H celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, lifeblood, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, subroutine_recalibration, prodigys_potency, strife, potion_of_unbridled_fury
0:05.453 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, lifeblood, guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, subroutine_recalibration, prodigys_potency(2), strife, potion_of_unbridled_fury
0:05.453 default J starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, subroutine_recalibration, prodigys_potency(2), strife, potion_of_unbridled_fury
0:06.208 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(2), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, subroutine_recalibration, prodigys_potency(2), strife, potion_of_unbridled_fury
0:06.965 default J starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(3), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, subroutine_recalibration, prodigys_potency(2), strife, potion_of_unbridled_fury
0:07.721 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(4), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, prodigys_potency(2), strife, potion_of_unbridled_fury
0:08.475 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, lifeblood(2), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms, prodigys_potency(2), strife, potion_of_unbridled_fury
0:09.228 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, lifeblood(2), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(2), prodigys_potency(2), strife, potion_of_unbridled_fury
0:09.982 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(2), prodigys_potency(2), strife, potion_of_unbridled_fury
0:10.738 default Q solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(2), prodigys_potency(2), strife(2), potion_of_unbridled_fury
0:11.492 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(2), prodigys_potency(2), overwhelming_power(24), strife(2), potion_of_unbridled_fury
0:12.247 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(2), prodigys_potency(4), overwhelming_power(23), strife(2), potion_of_unbridled_fury
0:13.001 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(2), prodigys_potency(4), overwhelming_power(22), strife(2), potion_of_unbridled_fury
0:13.754 default J starsurge Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(3), prodigys_potency(4), overwhelming_power(22), strife(2), potion_of_unbridled_fury
0:14.507 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(3), prodigys_potency(4), overwhelming_power(21), strife(2), potion_of_unbridled_fury
0:15.261 default M sunfire Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(3), prodigys_potency(4), overwhelming_power(20), strife(2), potion_of_unbridled_fury
0:16.015 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(3), prodigys_potency(4), overwhelming_power(19), strife(2), potion_of_unbridled_fury
0:16.770 default N moonfire Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), recalibrating, highborne_compendium_of_storms(4), prodigys_potency(4), overwhelming_power(19), strife(2), potion_of_unbridled_fury
0:17.524 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(4), overwhelming_power(18), strife(2), potion_of_unbridled_fury
0:18.278 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(4), overwhelming_power(17), strife(2), potion_of_unbridled_fury
0:19.066 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(4), overwhelming_power(16), strife(2), potion_of_unbridled_fury
0:19.820 default P lunar_strike Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(4), overwhelming_power(16), strife(2), potion_of_unbridled_fury
0:20.611 default J starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(15), strife(2), potion_of_unbridled_fury
0:21.366 default O stellar_flare Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(14), strife(2), potion_of_unbridled_fury
0:22.121 default J starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(13), strife(2), potion_of_unbridled_fury
0:22.875 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(13), strife(3), potion_of_unbridled_fury
0:23.629 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(12), strife(3), potion_of_unbridled_fury
0:24.439 default K sunfire Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(11), strife(3), potion_of_unbridled_fury
0:25.192 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(10), strife(3), potion_of_unbridled_fury
0:25.945 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(10), strife(4), potion_of_unbridled_fury
0:26.857 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(9), strife(4), potion_of_unbridled_fury
0:27.774 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(8), strife(4), potion_of_unbridled_fury
0:28.691 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(7), strife(4), potion_of_unbridled_fury
0:29.446 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(6), strife(4), potion_of_unbridled_fury
0:30.200 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(5), strife(5), potion_of_unbridled_fury
0:30.956 default Q solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(5), strife(5), potion_of_unbridled_fury
0:31.710 default Q solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(5), overwhelming_power(4), strife(5), potion_of_unbridled_fury
0:32.464 default J starsurge Fluffy_Pillow 98.5/100: 99% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(3), strife(5), potion_of_unbridled_fury
0:33.218 default Q solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(2), strife(5), potion_of_unbridled_fury
0:33.972 default J starsurge Fluffy_Pillow 79.5/100: 80% astral_power bloodlust, lifeblood(4), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power(2), strife(5), potion_of_unbridled_fury
0:34.724 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(6), overwhelming_power, strife(5), potion_of_unbridled_fury
0:35.478 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(6), strife(5), potion_of_unbridled_fury
0:36.231 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(7), strife(5), potion_of_unbridled_fury
0:36.987 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(7), strife(5), potion_of_unbridled_fury
0:37.813 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(7), strife(5), potion_of_unbridled_fury
0:38.566 default L moonfire Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(7), strife(5), potion_of_unbridled_fury
0:39.321 default P lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(7), strife(5), potion_of_unbridled_fury
0:40.271 default P lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), lunar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(7), strife(5), potion_of_unbridled_fury
0:41.220 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power lifeblood(4), arcanic_pulsar(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(7), strife(6), potion_of_unbridled_fury
0:42.275 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(7), strife(6), potion_of_unbridled_fury
0:43.299 default M sunfire Fluffy_Pillow 8.5/100: 9% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(7), strife(6), potion_of_unbridled_fury
0:44.407 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(7), strife(6), potion_of_unbridled_fury
0:45.815 default O stellar_flare Fluffy_Pillow 25.5/100: 26% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(7), strife(7), potion_of_unbridled_fury
0:46.922 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(7), strife(7), potion_of_unbridled_fury
0:48.332 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(2), recalibrating, highborne_compendium_of_storms(4), prodigys_potency(7), strife(8), potion_of_unbridled_fury
0:49.459 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), strife(8), potion_of_unbridled_fury
0:50.359 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), strife(8), potion_of_unbridled_fury
0:51.708 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(8), potion_of_unbridled_fury
0:52.607 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(8), potion_of_unbridled_fury
0:53.665 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(8), potion_of_unbridled_fury
0:54.563 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(8), potion_of_unbridled_fury
0:55.910 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(8), potion_of_unbridled_fury
0:57.258 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(8), potion_of_unbridled_fury
0:58.159 default P lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), strife(8)
0:59.507 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), strife(8)
1:00.406 default Q solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), strife(8)
1:01.306 default J starsurge Fluffy_Pillow 87.5/100: 88% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), strife(8)
1:02.458 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(10), strife(8)
1:03.484 default M sunfire Fluffy_Pillow 9.0/100: 9% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(10), strife(8)
1:04.498 default N moonfire Fluffy_Pillow 12.5/100: 13% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(10), strife(8)
1:05.512 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:06.359 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:07.629 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:08.627 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:09.379 default O stellar_flare Fluffy_Pillow 27.0/100: 27% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:10.221 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:10.974 default P lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:12.050 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:12.805 default J starsurge Fluffy_Pillow 69.5/100: 70% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:13.648 default K sunfire Fluffy_Pillow 30.0/100: 30% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:14.584 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:15.955 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:17.328 default P lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:18.697 default Q solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power lifeblood(4), arcanic_pulsar, solar_empowerment(2), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:19.612 default Q solar_wrath Fluffy_Pillow 85.0/100: 85% astral_power lifeblood(4), arcanic_pulsar, solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:20.527 default I cancel_buff Fluffy_Pillow 93.5/100: 94% astral_power lifeblood(4), arcanic_pulsar, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:20.527 default J starsurge Fluffy_Pillow 93.5/100: 94% astral_power lifeblood(4), arcanic_pulsar, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:21.701 default J starsurge Fluffy_Pillow 54.0/100: 54% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:22.819 default N moonfire Fluffy_Pillow 15.0/100: 15% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), strife(8)
1:23.908 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(13), strife(8)
1:25.294 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(14), strife(8)
1:26.221 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), strife(8)
1:27.310 default Q solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power lifeblood(3), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(17), strife(8)
1:28.211 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, torrent_of_elements, prodigys_potency(17), strife(8)
1:29.598 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power lifeblood(2), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms, torrent_of_elements, prodigys_potency(18), strife(8)
1:30.974 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms, torrent_of_elements, prodigys_potency(18), strife(8)
1:31.894 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms, torrent_of_elements, prodigys_potency(18), strife(8)
1:32.884 default M sunfire Fluffy_Pillow 8.5/100: 9% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms, torrent_of_elements, prodigys_potency(18), strife(8)
1:33.873 default O stellar_flare Fluffy_Pillow 12.5/100: 13% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(2), torrent_of_elements, prodigys_potency(18), strife(8)
1:34.857 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(2), torrent_of_elements, prodigys_potency(18), strife(8)
1:36.108 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(3), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(3), torrent_of_elements, prodigys_potency(18), strife(8)
1:36.938 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(3), torrent_of_elements, prodigys_potency(18), strife(8)
1:37.768 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(3), prodigys_potency(19), overwhelming_power(25), strife(8)
1:38.535 default P lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(3), prodigys_potency(19), overwhelming_power(24), strife(8)
1:39.690 default Q solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power lifeblood(4), arcanic_pulsar(5), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(23), strife(8)
1:40.594 default J starsurge Fluffy_Pillow 81.0/100: 81% astral_power lifeblood(4), arcanic_pulsar(5), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(22), strife(8)
1:41.583 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(21), strife(8)
1:42.543 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(20), strife(8)
1:43.737 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(19), strife(8)
1:44.933 default N moonfire Fluffy_Pillow 27.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(2), starlord(2), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(18), strife(8)
1:45.973 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(2), starlord(2), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(17), strife(8)
1:46.861 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment, starlord(2), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(16), strife(8)
1:47.908 default P lunar_strike Fluffy_Pillow 0.5/100: 1% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(15), strife(8)
1:49.209 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(13), strife(8)
1:50.083 default M sunfire Fluffy_Pillow 22.0/100: 22% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), overwhelming_power(12), strife(8)
1:51.099 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), overwhelming_power(11), strife(8)
1:51.964 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(20), overwhelming_power(11), strife(8)
1:53.001 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(20), overwhelming_power(9), strife(8)
1:54.332 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), overwhelming_power(8), strife(8)
1:55.209 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), overwhelming_power(7), strife(8)
1:56.241 default Q solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), overwhelming_power(6), strife(8)
1:57.278 default O stellar_flare Fluffy_Pillow 82.0/100: 82% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), overwhelming_power(5), strife(8)
1:58.319 default I cancel_buff Fluffy_Pillow 90.5/100: 91% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), overwhelming_power(4), strife(8)
1:58.319 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), overwhelming_power(4), strife(8)
1:59.454 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), overwhelming_power(3), strife(8)
2:00.277 default J starsurge Fluffy_Pillow 76.0/100: 76% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), overwhelming_power(2), strife(8)
2:01.244 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(20), overwhelming_power, strife(8)
2:01.999 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(20), overwhelming_power, strife(8)
2:03.098 default J starsurge Fluffy_Pillow 62.0/100: 62% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(20), strife(8)
2:03.965 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(20), strife(8)
2:04.719 default K sunfire Fluffy_Pillow 31.0/100: 31% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:05.564 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:06.798 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:07.768 default N moonfire Fluffy_Pillow 12.0/100: 12% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:08.738 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:09.971 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:11.225 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:12.062 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:13.047 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:13.963 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:15.335 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:16.248 default P lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:17.621 default P lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:18.993 default J starsurge Fluffy_Pillow 66.5/100: 67% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:20.147 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8)
2:21.098 default O stellar_flare Fluffy_Pillow 40.0/100: 40% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8)
2:22.216 default P lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8)
2:23.643 default J starsurge Fluffy_Pillow 61.5/100: 62% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8)
2:24.764 default M sunfire Fluffy_Pillow 22.5/100: 23% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(23), strife(8)
2:25.853 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(24), strife(8)
2:26.707 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(23), strife(8)
2:27.990 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(22), strife(8)
2:29.017 default N moonfire Fluffy_Pillow 12.0/100: 12% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(20), strife(8)
2:30.023 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(19), strife(8)
2:30.869 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(19), strife(8)
2:32.031 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(17), strife(8)
2:32.949 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(17), strife(8)
2:33.730 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(16), strife(8)
2:34.906 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(15), strife(8)
2:36.085 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(13), strife(8)
2:37.268 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(3), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(12), strife(8)
2:38.063 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(11), strife(8)
2:38.860 default P lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(11), strife(8)
2:40.055 default J starsurge Fluffy_Pillow 82.5/100: 83% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(9), strife(8)
2:41.082 default M sunfire Fluffy_Pillow 55.0/100: 55% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(8), strife(8)
2:41.953 default J starsurge Fluffy_Pillow 58.5/100: 59% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(8), strife(8)
2:42.822 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(7), strife(8)
2:43.576 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(6), strife(8)
2:44.776 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), recalibrating, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(5), strife(8)
2:45.739 default O stellar_flare Fluffy_Pillow 5.0/100: 5% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), recalibrating, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(4), strife(8)
2:46.679 default L moonfire Fluffy_Pillow 14.0/100: 14% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(3), strife(8)
2:47.607 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(2), strife(8)
2:48.517 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(25), overwhelming_power, strife(8)
2:49.883 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(25), strife(8)
2:51.230 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(25), strife(8)
2:52.128 default J starsurge Fluffy_Pillow 60.5/100: 61% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8)
2:53.186 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8)
2:54.086 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8)
2:55.434 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8)
2:56.332 default P lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8)
2:57.679 default Q solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8)
2:58.577 default Q solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8)
2:59.476 default I cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8)
2:59.476 default J starsurge Fluffy_Pillow 89.5/100: 90% astral_power lifeblood(4), arcanic_pulsar(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8)
3:00.631 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8)
3:01.751 default M sunfire Fluffy_Pillow 15.0/100: 15% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8)
3:02.764 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8)
3:04.053 default G guardian_of_azeroth Fluffy_Pillow 31.5/100: 32% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8)
3:05.049 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(29), strife(8)
3:06.320 default H celestial_alignment Fluffy_Pillow 45.0/100: 45% astral_power lifeblood(4), guardian_of_azeroth, arcanic_pulsar(5), celestial_alignment, solar_empowerment(2), starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(29), strife(8)
3:07.172 default E potion Fluffy_Pillow 89.5/100: 90% astral_power lifeblood(4), guardian_of_azeroth(2), arcanic_pulsar(5), celestial_alignment, solar_empowerment(2), starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(29), strife(8)
3:07.172 default F berserking Fluffy_Pillow 89.5/100: 90% astral_power lifeblood(4), guardian_of_azeroth(2), arcanic_pulsar(5), celestial_alignment, solar_empowerment(2), starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(29), strife(8), potion_of_unbridled_fury
3:07.172 default J starsurge Fluffy_Pillow 89.5/100: 90% astral_power berserking, lifeblood(4), guardian_of_azeroth(2), arcanic_pulsar(5), celestial_alignment, solar_empowerment(2), starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(29), strife(8), potion_of_unbridled_fury
3:07.931 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power berserking, lifeblood(4), guardian_of_azeroth(3), arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(29), strife(8), potion_of_unbridled_fury
3:08.685 default J starsurge Fluffy_Pillow 58.5/100: 59% astral_power berserking, lifeblood(4), guardian_of_azeroth(3), arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(29), strife(8), potion_of_unbridled_fury
3:09.441 default N moonfire Fluffy_Pillow 19.0/100: 19% astral_power berserking, lifeblood(4), guardian_of_azeroth(4), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(29), strife(8), potion_of_unbridled_fury
3:10.195 default O stellar_flare Fluffy_Pillow 26.5/100: 27% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8), potion_of_unbridled_fury
3:10.949 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8), potion_of_unbridled_fury
3:11.704 default P lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8), potion_of_unbridled_fury
3:12.594 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8), potion_of_unbridled_fury
3:13.348 default P lunar_strike Fluffy_Pillow 72.5/100: 73% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8), potion_of_unbridled_fury
3:14.335 default Q solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8), potion_of_unbridled_fury
3:15.089 default J starsurge Fluffy_Pillow 94.0/100: 94% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8), potion_of_unbridled_fury
3:15.862 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8), potion_of_unbridled_fury
3:16.616 default P lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8), potion_of_unbridled_fury
3:17.603 default M sunfire Fluffy_Pillow 79.5/100: 80% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:18.377 default Q solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:19.130 default I cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:19.130 default J starsurge Fluffy_Pillow 91.5/100: 92% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:19.977 default Q solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:20.743 default P lunar_strike Fluffy_Pillow 72.5/100: 73% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment(3), starlord, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:21.891 default J starsurge Fluffy_Pillow 85.5/100: 86% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:22.777 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:23.532 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:24.629 default J starsurge Fluffy_Pillow 67.0/100: 67% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:25.493 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:26.247 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:27.314 default J starsurge Fluffy_Pillow 49.0/100: 49% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:28.152 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:28.906 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:29.881 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:30.647 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:31.624 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:32.391 default N moonfire Fluffy_Pillow 12.5/100: 13% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:33.272 default O stellar_flare Fluffy_Pillow 16.0/100: 16% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:34.153 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:35.387 default M sunfire Fluffy_Pillow 37.5/100: 38% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:36.357 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:37.591 default P lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:38.847 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord(3), subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:39.685 default J starsurge Fluffy_Pillow 75.0/100: 75% astral_power lifeblood(4), arcanic_pulsar(4), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:40.741 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:42.048 default J starsurge Fluffy_Pillow 53.0/100: 53% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment, starlord, overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(34), strife(8), potion_of_unbridled_fury
3:43.187 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(34), strife(8), potion_of_unbridled_fury
3:44.596 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(2), starlord(2), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(34), strife(8), potion_of_unbridled_fury
3:45.538 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment, starlord(2), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(34), strife(8), potion_of_unbridled_fury
3:46.478 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power lifeblood(4), arcanic_pulsar(6), starlord(2), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(34), strife(8), potion_of_unbridled_fury
3:47.584 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(34), strife(8), potion_of_unbridled_fury
3:48.932 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(35), strife(8), potion_of_unbridled_fury
3:49.832 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power lifeblood(4), arcanic_pulsar(7), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(35), strife(8), potion_of_unbridled_fury
3:50.891 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power lifeblood(4), arcanic_pulsar(7), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(35), strife(8), potion_of_unbridled_fury
3:51.949 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power lifeblood(4), arcanic_pulsar(7), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(36), strife(8), potion_of_unbridled_fury
3:53.009 default M sunfire Fluffy_Pillow 4.0/100: 4% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(36), strife(8), potion_of_unbridled_fury
3:54.068 default N moonfire Fluffy_Pillow 8.0/100: 8% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(36), strife(8), potion_of_unbridled_fury
3:55.127 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(36), strife(8), potion_of_unbridled_fury
3:56.497 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(36), strife(8), potion_of_unbridled_fury
3:57.412 default O stellar_flare Fluffy_Pillow 33.0/100: 33% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(36), strife(8), potion_of_unbridled_fury
3:58.470 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(36), strife(8), potion_of_unbridled_fury
3:59.529 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(36), strife(8), potion_of_unbridled_fury
4:00.588 default J starsurge Fluffy_Pillow 59.0/100: 59% astral_power lifeblood(4), arcanic_pulsar(8), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(36), strife(8), potion_of_unbridled_fury
4:01.645 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(36), strife(8), potion_of_unbridled_fury
4:02.405 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), starlord, overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(36), strife(8), potion_of_unbridled_fury
4:03.298 default Q solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(36), strife(8), potion_of_unbridled_fury
4:04.052 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(36), strife(8), potion_of_unbridled_fury
4:05.156 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(36), strife(8), potion_of_unbridled_fury
4:06.024 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(36), strife(8), potion_of_unbridled_fury
4:07.128 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(36), strife(8), potion_of_unbridled_fury
4:07.996 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(36), strife(8)
4:09.232 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(37), strife(8)
4:10.466 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(37), strife(8)
4:11.699 default M sunfire Fluffy_Pillow 54.5/100: 55% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment(3), starlord(3), overclocking_bit_band, subroutine_recalibration, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(37), strife(8)
4:12.670 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment(3), starlord(3), recalibrating, highborne_compendium_of_storms(4), prodigys_potency(37), strife(8)
4:13.603 default J starsurge Fluffy_Pillow 67.0/100: 67% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(37), strife(8)
4:14.679 default N moonfire Fluffy_Pillow 27.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(37), strife(8)
4:15.756 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(37), strife(8)
4:16.671 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(37), strife(8)
4:18.043 default P lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, recalibrating, highborne_compendium_of_storms(4), prodigys_potency(37), strife(8)
4:19.414 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), strife(8)
4:20.313 default Q solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), strife(8)
4:21.212 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power lifeblood(4), arcanic_pulsar(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), strife(8)
4:22.366 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), strife(8)
4:23.484 default O stellar_flare Fluffy_Pillow 8.5/100: 9% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(38), strife(8)
4:24.572 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(38), overwhelming_power(25), strife(8)
4:25.845 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(38), overwhelming_power(24), strife(8)
4:27.125 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(38), overwhelming_power(22), strife(8)
4:27.987 default J starsurge Fluffy_Pillow 55.5/100: 56% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(38), overwhelming_power(22), strife(8)
4:28.996 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(39), overwhelming_power(21), strife(8)
4:29.850 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(39), overwhelming_power(20), strife(8)
4:31.132 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(2), starlord(3), subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(39), overwhelming_power(18), strife
4:31.924 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), subroutine_recalibration, highborne_compendium_of_storms(4), prodigys_potency(39), overwhelming_power(18), strife

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16715 15195 12905
Intellect 1467 -3 12229 10676 8704 (5789)
Spirit 0 0 0 0 0
Health 334300 303900 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 12229 10676 0
Crit 24.60% 23.31% 1318
Haste 24.38% 24.38% 1658
Damage / Heal Versatility 3.81% 3.81% 324
ManaReg per Second 2396 640 0
Attack Power 12718 11103 0
Mastery 37.17% 37.17% 1162
Armor 2828 2828 2828
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 433.00
Local Head Shroud of Unmooring Whispers
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
azerite powers: { Streaking Stars, Arcanic Pulsar, Overwhelming Power }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Shoulderpads of Frothing Rage
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
azerite powers: { Streaking Stars, Loyal to the End, Heed My Call }
Local Chest Tunic of the Sycophant
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
azerite powers: { Streaking Stars, Undulating Tides, Gutripper }
Local Waist Vim's Scalecrusher Clasp
ilevel: 425, stats: { 233 Armor, +358 AgiInt, +637 Sta, +102 Crit, +111 Haste }, gems: { +50 Haste }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Akana's Reefstrider Footwraps
ilevel: 425, stats: { 285 Armor, +358 AgiInt, +637 Sta, +102 Mastery, +111 Haste }, gems: { +50 Haste }
Local Wrists Ori's Tidal Wristwraps
ilevel: 425, stats: { 181 Armor, +268 AgiInt, +478 Sta, +87 Vers, +73 Haste }, gems: { +50 Haste }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Overclocking Bit Band
ilevel: 415, stats: { +430 Sta, +388 Haste, +97 Mastery }, enchant: { +60 Crit }
Local Finger2 Logic Loop of Recursion
ilevel: 415, stats: { +430 Sta, +361 Crit, +124 Haste }, enchant: { +60 Crit }
Local Trinket1 Pocket-Sized Computation Device
ilevel: 420
Local Trinket2 Highborne Compendium of Storms
ilevel: 400, stats: { +359 Int }
Local Back Shirakess Drape
ilevel: 425, stats: { 122 Armor, +268 StrAgiInt, +478 Sta, +83 Haste, +77 Mastery }, gems: { +50 Haste }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="recalibration"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
professions=engineering=100/jewelcrafting=100
talents=1000231
azerite_essences=14:3:1/32:3:0/4:3:0

# Default consumables
potion=unbridled_fury
flask=greater_flask_of_endless_fathoms
food=mechdowels_big_mech
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Azerite variables
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
# Starfall v Starsurge target cutoff
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6
actions+=/berserking,if=buff.ca_inc.up
# CDs
actions+=/use_item,name=azsharas_font_of_power,if=equipped.169314&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/guardian_of_azeroth,if=(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_item,name=pocketsized_computation_device,if=equipped.167555&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/use_item,name=shiver_venom_relic,if=equipped.168905&cooldown.ca_inc.remains>30&!buff.ca_inc.up
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(!talent.stellar_flare.enabled|dot.stellar_flare.remains>10)&!buff.ca_inc.up&(astral_power<25|cooldown.ca_inc.remains>30)
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/focused_azerite_beam
actions+=/thorns
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(buff.memory_of_lucid_dreams.up|ap_check)&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)
actions+=/celestial_alignment,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
# Spenders
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
# DoTs
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
# Generators
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
# Fallthru for movement
actions+=/sunfire

head=shroud_of_unmooring_whispers,id=168349,ilevel=450,azerite_powers=122/200/30
neck=heart_of_azeroth,id=158075,ilevel=463,azerite_level=65
shoulders=shoulderpads_of_frothing_rage,id=168348,ilevel=450,azerite_powers=122/576/22
back=shirakess_drape,id=169486,ilevel=425,gems=50haste
chest=tunic_of_the_sycophant,id=168350,ilevel=450,azerite_powers=122/575/31
wrists=oris_tidal_wristwraps,id=170305,ilevel=425,gems=50haste
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=vims_scalecrusher_clasp,id=170368,ilevel=425,gems=50haste
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=akanas_reefstrider_footwraps,id=170141,ilevel=425,gems=50haste
finger1=overclocking_bit_band,id=169159,ilevel=415,enchant=60crit
finger2=logic_loop_of_recursion,id=169158,ilevel=415,enchant=60crit
trinket1=pocketsized_computation_device,id=167555,ilevel=420,gem_id=168800/168742
trinket2=highborne_compendium_of_storms,id=169328,ilevel=400
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=433.20
# gear_stamina=12905
# gear_intellect=8704
# gear_crit_rating=1143
# gear_haste_rating=1658
# gear_mastery_rating=805
# gear_versatility_rating=266
# gear_armor=2828

sandbag : 51259 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
51258.9 51258.9 98.3 / 0.192% 6624.6 / 12.9% 5604.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.7 8.5 Astral Power 0.00% 61.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator
Professions
  • engineering: 100
  • jewelcrafting: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
sandbag 51259
Azerite Spike 1022 2.0% 17.9 15.96sec 17018 0 Direct 17.9 13813 28425 17040 22.1%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.92 17.90 0.00 0.00 0.0000 0.0000 304958.72 304958.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.95 77.93% 13813.16 12665 15347 13807.51 13130 14923 192663 192663 0.00
crit 3.95 22.07% 28424.97 26090 31616 27865.29 0 31616 112296 112296 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295835
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:90.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295835
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:{$@spelldesc295834=Your spells and abilities have a high chance to impale your target with a spike of Azerite, causing ${$m1*(1+$@versadmg)} Fire damage.$?a295837[ When an Azerite spike deals damage, all damage you deal against that target is increased by {$295838s1=5}% for {$295838d=6 seconds}.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11696.33
  • base_dd_max:11696.33
  • base_dd_mult:1.00
 
Conch Strike 373 0.7% 13.3 21.49sec 8384 0 Direct 13.1 6839 14096 8474 22.6%  

Stats details: conch_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.28 13.13 0.00 0.00 0.0000 0.0000 111304.33 159006.18 30.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.17 77.44% 6838.84 6415 7067 6838.79 6612 7032 69547 99353 30.00
crit 2.96 22.56% 14096.27 13215 14558 13466.45 0 14558 41757 59653 28.67
 
 

Action details: conch_strike

Static Values
  • id:304698
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:304698
  • name:Conch Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc304697=While in Nazjatar or the Eternal Palace, your spells and abilities have a chance to deal Physical damage and increased threat to enemies in a small area around the target. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8462.82
  • base_dd_max:8462.82
  • base_dd_mult:1.00
 
Frost Blast 569 1.1% 13.1 22.22sec 12956 0 Direct 13.1 10499 21669 12956 22.0%  

Stats details: frost_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.14 13.14 0.00 0.00 0.0000 0.0000 170231.78 170231.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.25 78.01% 10499.10 9623 11661 10499.37 9986 11258 107624 107624 0.00
crit 2.89 21.99% 21669.01 19824 24023 20511.82 0 24023 62608 62608 0.00
 
 

Action details: frost_blast

Static Values
  • id:304645
  • school:frost
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:304645
  • name:Frost Blast
  • school:frost
  • tooltip:Slowed.
  • description:{$@spelldesc304640=While in Nazjatar or the Eternal Palace, your spells and abilities have a chance to deal {$304645s1=0} Frost damage to your target, slowing them for {$304645d=6 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8887.35
  • base_dd_max:8887.35
  • base_dd_mult:1.00
 
Gutripper 522 1.0% 38.2 7.64sec 4070 0 Direct 38.2 3308 6813 4070 21.7%  

Stats details: gutripper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.15 38.15 0.00 0.00 0.0000 0.0000 155264.57 221806.53 30.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.86 78.27% 3308.00 3100 3415 3309.11 3236 3381 98775 141107 30.00
crit 8.29 21.73% 6813.29 6386 7035 6815.81 6514 7035 56490 80700 30.00
 
 

Action details: gutripper

Static Values
  • id:269031
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:269031
  • name:Gutripper
  • school:physical
  • tooltip:
  • description:{$@spelldesc266937=Your damaging abilities have a chance to deal {$s1=1112} Physical damage to the target. Gutripper occurs much more often against targets below {$s2=30}% health. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4090.00
  • base_dd_max:4090.00
  • base_dd_mult:1.00
 
Heed My Call 351 (501) 0.7% (1.0%) 8.8 30.21sec 16907 0 Direct 8.8 9581 19740 11844 22.3%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.85 8.85 0.00 0.00 0.0000 0.0000 104780.59 104780.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.88 77.72% 9581.20 8778 10637 9585.67 9082 10383 65886 65886 0.00
crit 1.97 22.28% 19739.59 18082 21912 17396.81 0 21912 38895 38895 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 150 0.3% 8.8 30.21sec 5063 0 Direct 8.8 4108 8444 5063 22.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.85 8.85 0.00 0.00 0.0000 0.0000 44789.35 44789.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.90 77.99% 4108.38 3762 4559 4109.77 3867 4559 28347 28347 0.00
crit 1.95 22.01% 8444.12 7749 9391 7293.26 0 9391 16443 16443 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6004 11.7% 82.3 3.54sec 21785 17869 Direct 82.3 17658 36391 21785 22.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.30 82.30 0.00 0.00 1.2191 0.0000 1792910.63 1792910.63 0.00 17869.07 17869.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.17 77.97% 17657.69 10416 21746 17661.13 17058 18429 1133038 1133038 0.00
crit 18.13 22.03% 36391.16 22530 44796 36402.25 34335 39259 659873 659873 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2871 5.6% 14.2 21.28sec 60480 63207 Direct 14.2 2936 6045 3625 22.1%  
Periodic 237.6 2744 5655 3391 22.2% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.17 14.17 237.60 237.60 0.9569 1.2494 857023.17 857023.17 0.00 2760.87 63206.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.03 77.85% 2935.61 2376 3597 2935.03 2672 3175 32387 32387 0.00
crit 3.14 22.15% 6045.16 4894 7410 5824.53 0 7410 18971 18971 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.8 77.79% 2744.38 7 3349 2744.94 2675 2875 507241 507241 0.00
crit 52.8 22.21% 5654.98 314 6899 5656.56 5358 5913 298424 298424 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Potion of Unbridled Fury 1421 2.7% 79.5 3.13sec 5275 0 Direct 79.5 4273 8801 5276 22.1%  

Stats details: potion_of_unbridled_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.52 79.52 0.00 0.00 0.0000 0.0000 419506.98 419506.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.91 77.86% 4273.26 3898 4724 4273.25 4130 4529 264573 264573 0.00
crit 17.61 22.14% 8800.72 8030 9731 8799.49 8458 9404 154934 154934 0.00
 
 

Action details: potion_of_unbridled_fury

Static Values
  • id:300717
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:300717
  • name:Potion of Unbridled Fury
  • school:fire
  • tooltip:
  • description:Deal {$s1=3600} Fire damage to your current target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3600.00
  • base_dd_max:3600.00
  • base_dd_mult:1.00
 
Shooting Stars 1039 2.0% 47.1 6.30sec 6584 0 Direct 47.1 5341 10982 6584 22.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.10 47.10 0.00 0.00 0.0000 0.0000 310094.94 310094.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.72 77.97% 5341.29 4300 6511 5342.01 5036 5678 196150 196150 0.00
crit 10.38 22.03% 10982.31 8858 13412 10985.57 10146 12366 113945 113945 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3768 (5442) 7.4% (10.6%) 101.7 2.88sec 15987 18500 Direct 102.1 8921 18388 11021 22.2%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.66 102.13 0.00 0.00 0.8641 0.0000 1125402.84 1125402.84 0.00 18500.10 18500.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.48 77.83% 8920.87 7167 10851 8924.10 8585 9255 709055 709055 0.00
crit 22.64 22.17% 18388.29 14763 22354 18391.03 17344 19876 416348 416348 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (_empowered) 1674 3.3% 79.1 3.71sec 6317 0 Direct 79.1 6318 0 6318 0.0%  

Stats details: solar_wrath_empowered

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.11 79.11 0.00 0.00 0.0000 0.0000 499738.87 499738.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.11 100.00% 6318.20 4314 12742 6317.58 5576 7104 499739 499739 0.00
 
 

Action details: solar_wrath_empowered

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10552.03
  • base_dd_max:10552.03
  • base_dd_mult:1.00
 
Starsurge 13608 26.6% 64.8 4.64sec 62692 63508 Direct 64.6 50828 104892 62882 22.3%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.80 64.60 0.00 0.00 0.9871 0.0000 4062561.78 4062561.78 0.00 63508.29 63508.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.19 77.69% 50828.02 41211 61974 50839.46 48892 52831 2550919 2550919 0.00
crit 14.41 22.31% 104891.58 84896 127666 104901.56 97425 115453 1511643 1511643 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1872 3.7% 12.8 23.56sec 43804 45207 Direct 12.8 2517 5188 3113 22.3%  
Periodic 235.6 1783 3674 2204 22.2% 98.5%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.76 12.76 235.55 235.55 0.9690 1.2495 558756.76 558756.76 0.00 1821.95 45206.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.91 77.67% 2516.90 2048 3101 2517.71 2314 2822 24938 24938 0.00
crit 2.85 22.33% 5188.48 4219 6388 4917.12 0 6388 14778 14778 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 183.2 77.77% 1783.33 94 2171 1783.72 1723 1867 326692 326692 0.00
crit 52.4 22.23% 3673.75 535 4472 3675.13 3522 3901 192349 192349 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Storm of the Eternal 524 1.0% 6.0 120.00sec 25811 0 Direct 6.0 21089 43464 25899 21.5%  

Stats details: storm_of_the_eternal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 5.98 0.00 0.00 0.0000 0.0000 154865.87 154865.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.69 78.47% 21088.52 19370 23473 21088.88 19608 23473 98927 98927 0.00
crit 1.29 21.53% 43463.82 39903 48353 34187.58 0 48353 55939 55939 0.00
 
 

Action details: storm_of_the_eternal

Static Values
  • id:303725
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303725
  • name:Storm of the Eternal
  • school:arcane
  • tooltip:
  • description:{$@spelldesc303733=Storm of the Eternal rises for {$303723d=10 seconds} every {$303722d=120 seconds}, dealing ${{$s1=0}*(1+$@versadmg)} Arcane damage {$303724u=3} times to a random enemy within $303725A1 yds. All Storm of the Eternal effects occur simultaneously.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17887.88
  • base_dd_max:17887.88
  • base_dd_mult:1.00
 
Storms Reckoning 902 1.8% 53.5 5.51sec 5038 0 Direct 53.2 4102 8452 5070 22.2%  

Stats details: storms_reckoning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.50 53.16 0.00 0.00 0.0000 0.0000 269494.97 269494.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.33 77.76% 4102.19 3761 4557 4101.94 3949 4275 169552 169552 0.00
crit 11.82 22.24% 8452.05 7747 9388 8451.33 8020 9033 99943 99943 0.00
 
 

Action details: storms_reckoning

Static Values
  • id:300917
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:15.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:300917
  • name:Storms Reckoning
  • school:nature
  • tooltip:
  • description:{$@spelldesc300913=Your spells have a chance to conjure a typhoon that travels towards enemies dealing {$300917s1=0} Nature damage and grant you $300919s~1 Haste for {$300919d=15 seconds}, up to ${$300919s*{$300919u=4}} Haste. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3473.28
  • base_dd_max:3473.28
  • base_dd_mult:1.00
 
Streaking Star 7082 13.8% 97.9 2.87sec 21488 0 Direct 97.9 17359 35750 21487 22.5%  

Stats details: streaking_star

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.85 97.85 0.00 0.00 0.0000 0.0000 2102586.87 2102586.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.88 77.55% 17359.33 15764 19102 17357.73 16770 18241 1317142 1317142 0.00
crit 21.97 22.45% 35750.10 32473 39351 35747.65 34287 37640 785445 785445 0.00
 
 

Action details: streaking_star

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3182 6.2% 17.6 17.05sec 54027 55958 Direct 17.6 4053 8373 5017 22.3%  
Periodic 236.8 2949 6072 3639 22.1% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.58 17.58 236.85 236.85 0.9655 1.2494 949997.15 949997.15 0.00 3036.11 55957.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.66 77.68% 4052.52 3277 4962 4051.77 3821 4317 55348 55348 0.00
crit 3.93 22.32% 8372.78 6751 10221 8225.31 0 10221 32866 32866 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.5 77.92% 2948.93 6 3597 2949.65 2859 3095 544215 544215 0.00
crit 52.3 22.08% 6072.12 56 7410 6073.55 5754 6415 317568 317568 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Undulating Tides 1788 3.5% 53.3 5.53sec 10018 0 Direct 53.1 8125 16750 10051 22.4%  

Stats details: undulating_tides

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.31 53.12 0.00 0.00 0.0000 0.0000 534073.40 534073.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.24 77.64% 8125.38 7449 9027 8125.30 7895 8478 335107 335107 0.00
crit 11.88 22.36% 16750.00 15345 18595 16747.27 15978 17859 198967 198967 0.00
 
 

Action details: undulating_tides

Static Values
  • id:303389
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303389
  • name:Undulating Tides
  • school:frost
  • tooltip:
  • description:{$@spelldesc303008=Your damaging spells and abilities have a chance to crash a wave upon your target for {$s1=1870} Frost damage. When your health drops below {$s2=50}%, gain a shield absorbing {$s3=14665} damage within {$303390d=8 seconds}. When this occurs, Undulating Tides cannot trigger again for {$s4=45} sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6879.00
  • base_dd_max:6879.00
  • base_dd_mult:1.00
 
pet - guardian_of_azeroth 12483 / 2538
Azerite Spike 11125 4.4% 61.4 3.45sec 10862 11323 Direct 61.4 8901 17805 10863 22.0%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.45 61.45 0.00 0.00 0.9594 0.0000 667475.59 667475.59 0.00 11322.55 11322.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.91 77.97% 8900.77 8233 9070 8900.77 8721 9001 426448 426448 0.00
crit 13.54 22.03% 17805.08 16466 18139 17805.40 17398 18091 241027 241027 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295856
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295856
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:Strike your target with a shard of Azerite, dealing {$s1=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7602.61
  • base_dd_max:7602.61
  • base_dd_mult:1.00
 
Azerite Volley 1359 0.5% 6.0 39.29sec 13588 0 Direct 6.0 11161 22330 13589 21.7%  

Stats details: azerite_volley

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 81527.29 81527.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.70 78.27% 11161.22 10805 11336 11162.06 10805 11336 52417 52417 0.00
crit 1.30 21.73% 22330.34 21610 22672 17648.85 0 22672 29111 29111 0.00
 
 

Action details: azerite_volley

Static Values
  • id:303351
  • school:flamestrike
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303351
  • name:Azerite Volley
  • school:flamestrike
  • tooltip:
  • description:{$@spelldesc295841=Every $303347t1 sec, the Guardian of Azeroth will launch of volley of Azerite Spikes at the target area, dealing {$s1=2287} damage to all enemies near its target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9502.90
  • base_dd_max:9502.90
  • base_dd_mult:1.00
 
Simple Action Stats Execute Interval
sandbag
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:sandbag
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.63sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.49sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8400 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Greater Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:298837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:sandbag
  • harmful:false
  • if_expr:
 
Well Fed (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:297039
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:sandbag
  • harmful:false
  • if_expr:
 
Guardian of Azeroth 2.0 180.46sec

Stats details: guardian_of_azeroth

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9784 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: guardian_of_azeroth

Static Values
  • id:295840
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
Spelldata
  • id:295840
  • name:Guardian of Azeroth
  • school:physical
  • tooltip:
  • description:Call upon Azeroth to summon a Guardian of Azeroth for {$300091d=30 seconds} who impales your target with spikes of Azerite every 2 sec that deal ${$295834m1*(1+$@versadmg)} Fire damage.$?a295841[ Every $303347t1 sec, the Guardian launches a volley of Azerite Spikes at its target, dealing {$295841s1=2287} Fire damage to all nearby enemies.][]$?a295843[ Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.][]
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Potion of Unbridled Fury (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:300714
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.7 56.9 41.7sec 4.7sec 93.62% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.14%
  • arcanic_pulsar_2:10.93%
  • arcanic_pulsar_3:12.14%
  • arcanic_pulsar_4:11.39%
  • arcanic_pulsar_5:12.52%
  • arcanic_pulsar_6:10.32%
  • arcanic_pulsar_7:11.78%
  • arcanic_pulsar_8:13.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.13% 12.46% 0.0(0.0) 2.0

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.56% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 7.8 0.0 40.3sec 40.3sec 26.89% 33.99% 0.0(0.0) 7.6

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Greater Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_greater_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:360.00

Stack Uptimes

  • greater_flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298837
  • name:Greater Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=360} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Guardian of Azeroth 2.0 59.4 180.7sec 3.5sec 19.45% 0.00% 51.4(51.4) 0.0

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_guardian_of_azeroth
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • guardian_of_azeroth_1:0.79%
  • guardian_of_azeroth_2:0.71%
  • guardian_of_azeroth_3:0.67%
  • guardian_of_azeroth_4:0.63%
  • guardian_of_azeroth_5:16.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295855
  • name:Guardian of Azeroth
  • tooltip:Haste increased by {$s1=2}%.
  • description:{$@spelldesc295843=Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.}
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Highborne Compendium of Storms 2.8 50.7 98.5sec 5.5sec 97.39% 0.00% 43.1(43.1) 1.8

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_highborne_compendium_of_storms
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Highborne Compendium of Storms

Stat Buff details

  • stat:haste_rating
  • amount:64.39

Stack Uptimes

  • highborne_compendium_of_storms_1:4.78%
  • highborne_compendium_of_storms_2:4.41%
  • highborne_compendium_of_storms_3:4.28%
  • highborne_compendium_of_storms_4:83.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:300919
  • name:Highborne Compendium of Storms
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc300913=Your spells have a chance to conjure a typhoon that travels towards enemies dealing {$300917s1=0} Nature damage and grant you $300919s~1 Haste for {$300919d=15 seconds}, up to ${$300919s*{$300919u=4}} Haste. }
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Lifeblood 108.2 0.0 150.3sec 2.7sec 98.42% 0.00% 102.0(110.2) 0.0

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_lifeblood
  • max_stacks:4
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:229.17

Stack Uptimes

  • lifeblood_1:1.21%
  • lifeblood_2:1.18%
  • lifeblood_3:2.01%
  • lifeblood_4:94.03%

Trigger Attempt Success

  • trigger_pct:92.30%

Spelldata details

  • id:295137
  • name:Lifeblood
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by ${$w1+$w2+$w3}.
  • description:{$@spelldesc295078=Every {$s4=18}-{$s1=25} sec, a Lifeblood Shard erupts from the nearby ground for {$295114d=12 seconds}.$?!s295186&a295078[ $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within ${$m2*(1+($295160m1/100))} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.][]}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 37.1 48.5 8.2sec 3.5sec 81.35% 99.71% 2.3(2.3) 0.0

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.92%
  • lunar_empowerment_2:30.48%
  • lunar_empowerment_3:14.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (mechdowels_big_mech) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_mechdowels_big_mech
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:93.00

Stack Uptimes

  • mechdowels_big_mech_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297039
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=93} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overclocking Bit Band 17.8 0.0 17.2sec 17.3sec 87.11% 0.00% 0.0(0.0) 16.9

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_overclocking_bit_band
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:160.00

Stack Uptimes

  • overclocking_bit_band_1:87.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:301886
  • name:Overclocking Bit Band
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc300126=...then you gain {$s1=0} Haste for {$s2=15} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.7 3.8 63.2sec 32.3sec 49.98% 0.00% 3.8(53.5) 0.0

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.41%
  • overwhelming_power_2:1.44%
  • overwhelming_power_3:1.49%
  • overwhelming_power_4:1.53%
  • overwhelming_power_5:1.58%
  • overwhelming_power_6:1.63%
  • overwhelming_power_7:1.67%
  • overwhelming_power_8:1.72%
  • overwhelming_power_9:1.77%
  • overwhelming_power_10:1.83%
  • overwhelming_power_11:1.88%
  • overwhelming_power_12:1.94%
  • overwhelming_power_13:2.00%
  • overwhelming_power_14:2.07%
  • overwhelming_power_15:2.13%
  • overwhelming_power_16:2.19%
  • overwhelming_power_17:2.26%
  • overwhelming_power_18:2.34%
  • overwhelming_power_19:2.41%
  • overwhelming_power_20:2.50%
  • overwhelming_power_21:2.57%
  • overwhelming_power_22:2.65%
  • overwhelming_power_23:2.73%
  • overwhelming_power_24:2.81%
  • overwhelming_power_25:1.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Unbridled Fury 2.0 0.0 188.3sec 0.0sec 39.88% 0.00% 0.0(0.0) 1.9

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_potion_of_unbridled_fury
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • potion_of_unbridled_fury_1:39.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:300714
  • name:Potion of Unbridled Fury
  • tooltip:Chance to deal an extra {$300717s1=3600} Fire damage to your current target.
  • description:Fill yourself with unbridled energy, giving your offensive spells and attacks a chance to do an additional {$300717s1=3600} Fire damage to your target. Lasts {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Prodigy's Potency 1.0 43.5 0.0sec 6.6sec 98.25% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_prodigys_potency
  • max_stacks:999
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prodigys_potency_1:1.54%
  • prodigys_potency_2:1.48%
  • prodigys_potency_3:1.47%
  • prodigys_potency_4:1.63%
  • prodigys_potency_5:1.77%
  • prodigys_potency_6:1.94%
  • prodigys_potency_7:2.09%
  • prodigys_potency_8:2.17%
  • prodigys_potency_9:2.41%
  • prodigys_potency_10:2.35%
  • prodigys_potency_11:2.36%
  • prodigys_potency_12:2.47%
  • prodigys_potency_13:2.48%
  • prodigys_potency_14:2.55%
  • prodigys_potency_15:2.54%
  • prodigys_potency_16:2.43%
  • prodigys_potency_17:2.45%
  • prodigys_potency_18:2.47%
  • prodigys_potency_19:2.45%
  • prodigys_potency_20:2.39%
  • prodigys_potency_21:2.42%
  • prodigys_potency_22:2.41%
  • prodigys_potency_23:2.39%
  • prodigys_potency_24:2.51%
  • prodigys_potency_25:2.27%
  • prodigys_potency_26:2.38%
  • prodigys_potency_27:2.19%
  • prodigys_potency_28:2.24%
  • prodigys_potency_29:2.26%
  • prodigys_potency_30:2.19%
  • prodigys_potency_31:2.19%
  • prodigys_potency_32:2.22%
  • prodigys_potency_33:2.20%
  • prodigys_potency_34:2.10%
  • prodigys_potency_35:2.04%
  • prodigys_potency_36:2.04%
  • prodigys_potency_37:1.99%
  • prodigys_potency_38:1.83%
  • prodigys_potency_39:1.87%
  • prodigys_potency_40:1.64%
  • prodigys_potency_41:1.57%
  • prodigys_potency_42:1.46%
  • prodigys_potency_43:1.29%
  • prodigys_potency_44:1.18%
  • prodigys_potency_45:1.01%
  • prodigys_potency_46:0.94%
  • prodigys_potency_47:0.80%
  • prodigys_potency_48:0.68%
  • prodigys_potency_49:0.55%
  • prodigys_potency_50:0.45%
  • prodigys_potency_51:0.35%
  • prodigys_potency_52:0.30%
  • prodigys_potency_53:0.24%
  • prodigys_potency_54:0.22%
  • prodigys_potency_55:0.16%
  • prodigys_potency_56:0.12%
  • prodigys_potency_57:0.11%
  • prodigys_potency_58:0.06%
  • prodigys_potency_59:0.04%
  • prodigys_potency_60:0.04%
  • prodigys_potency_61:0.04%
  • prodigys_potency_62:0.04%
  • prodigys_potency_63:0.01%
  • prodigys_potency_64:0.02%
  • prodigys_potency_65:0.01%
  • prodigys_potency_66:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:303017
  • name:Prodigy's Potency
  • tooltip:$w1 damage and healing stored.
  • description:
  • max_stacks:999
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
Solar Empowerment 28.4 52.9 10.5sec 3.7sec 84.17% 77.59% 0.2(0.2) 0.0

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.58%
  • solar_empowerment_2:38.18%
  • solar_empowerment_3:15.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 49.5 20.2sec 4.6sec 97.95% 96.89% 19.4(19.4) 11.4

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:13.40%
  • starlord_2:21.52%
  • starlord_3:63.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Strife 2.1 52.3 113.2sec 5.4sec 97.68% 0.00% 39.5(39.5) 1.1

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_strife
  • max_stacks:8
  • duration:14.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:53.82

Stack Uptimes

  • strife_1:3.72%
  • strife_2:3.64%
  • strife_3:3.51%
  • strife_4:3.44%
  • strife_5:3.30%
  • strife_6:3.24%
  • strife_7:3.09%
  • strife_8:73.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:304056
  • name:Strife
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc304081=Your spells and abilities have a chance to increase your Versatility by {$s1=0} for {$304056d=8 seconds}, stacking up to {$304056u=5} times. Being the vicitim of a loss of control or movement impairing effect also grants a stack of Strife.}
  • max_stacks:5
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.2sec 45.1sec 23.73% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.73%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
unempowered_solar_wrath 23.2 12.6sec
unempowered_lunar_strike 0.2 66.4sec
wasted_streaking_star 0.0 0.0sec
arcanic_pulsar_proc 6.7 42.8sec

Resources

Resource Usage Type Count Total Average RPE APR
sandbag
starsurge Astral Power 64.8 2592.3 40.0 40.0 1567.2
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 102.65 821.12 (32.14%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.13%) 40.00 0.00 0.00%
sunfire Astral Power 17.59 52.76 (2.07%) 3.00 0.00 0.00%
shooting_stars Astral Power 47.12 188.46 (7.38%) 4.00 0.00 0.00%
moonfire Astral Power 14.17 42.51 (1.66%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.76 102.06 (3.99%) 8.00 0.00 0.00%
lunar_strike Astral Power 82.31 987.69 (38.66%) 12.00 0.06 0.01%
natures_balance Astral Power 399.02 199.51 (7.81%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.74 80.84 (3.16%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.55 8.67
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.69 0.50 43.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data sandbag Fight Length
Count 1192
Mean 298.89
Minimum 240.09
Maximum 359.91
Spread ( max - min ) 119.82
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data sandbag Damage Per Second
Count 1192
Mean 51258.87
Minimum 46944.93
Maximum 57762.56
Spread ( max - min ) 10817.63
Range [ ( max - min ) / 2 * 100% ] 10.55%
Standard Deviation 1731.1806
5th Percentile 48576.94
95th Percentile 54246.09
( 95th Percentile - 5th Percentile ) 5669.15
Mean Distribution
Standard Deviation 50.1423
95.00% Confidence Intervall ( 51160.59 - 51357.15 )
Normalized 95.00% Confidence Intervall ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4382
0.1 Scale Factor Error with Delta=300 25584
0.05 Scale Factor Error with Delta=300 102336
0.01 Scale Factor Error with Delta=300 2558400
Priority Target DPS
Sample Data sandbag Priority Target Damage Per Second
Count 1192
Mean 51258.87
Minimum 46944.93
Maximum 57762.56
Spread ( max - min ) 10817.63
Range [ ( max - min ) / 2 * 100% ] 10.55%
Standard Deviation 1731.1806
5th Percentile 48576.94
95th Percentile 54246.09
( 95th Percentile - 5th Percentile ) 5669.15
Mean Distribution
Standard Deviation 50.1423
95.00% Confidence Intervall ( 51160.59 - 51357.15 )
Normalized 95.00% Confidence Intervall ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4382
0.1 Scale Factor Error with Delta=300 25584
0.05 Scale Factor Error with Delta=300 102336
0.01 Scale Factor Error with Delta=300 2558400
DPS(e)
Sample Data sandbag Damage Per Second (Effective)
Count 1192
Mean 51258.87
Minimum 46944.93
Maximum 57762.56
Spread ( max - min ) 10817.63
Range [ ( max - min ) / 2 * 100% ] 10.55%
Damage
Sample Data sandbag Damage
Count 1192
Mean 14528343.60
Minimum 11618088.83
Maximum 17730397.93
Spread ( max - min ) 6112309.10
Range [ ( max - min ) / 2 * 100% ] 21.04%
DTPS
Sample Data sandbag Damage Taken Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data sandbag Healing Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data sandbag Healing Per Second (Effective)
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data sandbag Heal
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data sandbag Healing Taken Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data sandbag Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data sandbagTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data sandbag Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
Azerite variables
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
Starfall v Starsurge target cutoff
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6
F 2.00 berserking,if=buff.ca_inc.up
0.00 use_item,name=azsharas_font_of_power,if=equipped.169314&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
CDs
G 2.00 guardian_of_azeroth,if=(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
0.00 use_item,name=tidestorm_codex,if=equipped.165576
0.00 use_item,name=pocketsized_computation_device,if=equipped.167555&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
0.00 use_item,name=shiver_venom_relic,if=equipped.168905&cooldown.ca_inc.remains>30&!buff.ca_inc.up
0.00 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(!talent.stellar_flare.enabled|dot.stellar_flare.remains>10)&!buff.ca_inc.up&(astral_power<25|cooldown.ca_inc.remains>30)
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 focused_azerite_beam
0.00 thorns
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(buff.memory_of_lucid_dreams.up|ap_check)&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)
H 2.00 celestial_alignment,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 2.90 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
Spenders
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 64.81 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 2.65 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 2.69 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 14.59 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
DoTs
N 11.48 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.76 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
Generators
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 82.68 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 101.92 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.35 sunfire
Fallthru for movement

Sample Sequence

0123456789ACDJNMOGHFJQPQJQPJQPJQPMQNQPQJOJQPQJPPPQQQQJQJQJQPQKPNJPQPJOQPQJMQPQPQPQIJJNPQJQPPMOQQPQJQPIJQJQLPJPMPJPQPJOQPQPJQPQJMNQPQJQPPQPOQIJQJQJQPMNPJPPQJPQPQQJMOJPPPJNQPQPJPQQPMJQJQPOJLPPQJPQQQMQQQJPGHEFJQJQNJOQPQPJMQPQPQPJQJQPJQPQJLPPJMOPPQQQPJJPPQJQMPNQJQOPQQQQJQJQPJKPQJQNPPJQPOQQJPQJPQQQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask sandbag 58.0/100: 58% astral_power
Pre precombat 1 food sandbag 58.0/100: 58% astral_power
Pre precombat 2 augmentation sandbag 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power potion_of_unbridled_fury
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power potion_of_unbridled_fury
0:01.210 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, potion_of_unbridled_fury
0:02.097 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, strife, potion_of_unbridled_fury
0:02.985 default O stellar_flare Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, lifeblood, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, strife, potion_of_unbridled_fury
0:03.874 default G guardian_of_azeroth Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, lifeblood, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, prodigys_potency, strife, potion_of_unbridled_fury
0:04.761 default H celestial_alignment Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, lifeblood(2), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, prodigys_potency, strife(2), potion_of_unbridled_fury
0:05.533 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, lifeblood(2), guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, prodigys_potency, strife(2), potion_of_unbridled_fury
0:05.533 default J starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, lifeblood(2), guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, prodigys_potency, strife(2), potion_of_unbridled_fury
0:06.289 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, lifeblood(2), guardian_of_azeroth(2), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, prodigys_potency, strife(2), potion_of_unbridled_fury
0:07.045 default P lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, lifeblood(2), guardian_of_azeroth(3), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, prodigys_potency, strife(2), potion_of_unbridled_fury
0:07.865 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, berserking, lifeblood(2), guardian_of_azeroth(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, prodigys_potency, strife(2), potion_of_unbridled_fury
0:08.618 default J starsurge Fluffy_Pillow 81.5/100: 82% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency, strife(2), potion_of_unbridled_fury
0:09.372 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency, strife(2), potion_of_unbridled_fury
0:10.125 default P lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency, strife(2), potion_of_unbridled_fury
0:10.884 default J starsurge Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency, strife(2), potion_of_unbridled_fury
0:11.641 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency, strife(2), potion_of_unbridled_fury
0:12.395 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency, strife(2), potion_of_unbridled_fury
0:13.149 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency, strife(2), potion_of_unbridled_fury
0:13.904 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), strife(2), potion_of_unbridled_fury
0:14.658 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), strife(2), potion_of_unbridled_fury
0:15.414 default M sunfire Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), strife(2), potion_of_unbridled_fury
0:16.168 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:16.921 default N moonfire Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:17.676 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:18.431 default P lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:19.252 default Q solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:20.007 default J starsurge Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:20.761 default O stellar_flare Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:21.515 default J starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:22.271 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:23.025 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:23.869 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:24.624 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:25.379 default P lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), strife(3), potion_of_unbridled_fury
0:26.323 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(3), potion_of_unbridled_fury
0:27.265 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(3), potion_of_unbridled_fury
0:28.209 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(3), potion_of_unbridled_fury
0:28.964 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(3), potion_of_unbridled_fury
0:29.718 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(3), potion_of_unbridled_fury
0:30.472 default Q solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(3), potion_of_unbridled_fury
0:31.226 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(3), potion_of_unbridled_fury
0:31.980 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), potion_of_unbridled_fury
0:32.735 default J starsurge Fluffy_Pillow 71.5/100: 72% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), potion_of_unbridled_fury
0:33.490 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife, potion_of_unbridled_fury
0:34.244 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife, potion_of_unbridled_fury
0:34.998 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife, potion_of_unbridled_fury
0:35.752 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife, potion_of_unbridled_fury
0:36.654 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(2), potion_of_unbridled_fury
0:37.408 default K sunfire Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(2), potion_of_unbridled_fury
0:38.163 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(2), potion_of_unbridled_fury
0:39.198 default N moonfire Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(2), potion_of_unbridled_fury
0:40.013 default J starsurge Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(2), potion_of_unbridled_fury
0:40.900 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power bloodlust, lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(3), potion_of_unbridled_fury
0:41.997 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(3), potion_of_unbridled_fury
0:42.948 default P lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), strife(3), potion_of_unbridled_fury
0:44.374 default J starsurge Fluffy_Pillow 53.5/100: 54% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(4), potion_of_unbridled_fury
0:45.493 default O stellar_flare Fluffy_Pillow 14.0/100: 14% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(4), potion_of_unbridled_fury
0:46.582 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), highborne_compendium_of_storms(4), prodigys_potency(4), strife(4), potion_of_unbridled_fury
0:47.526 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), highborne_compendium_of_storms(4), prodigys_potency(4), strife(5), potion_of_unbridled_fury
0:48.936 default Q solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(5), potion_of_unbridled_fury
0:49.861 default J starsurge Fluffy_Pillow 53.0/100: 53% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(5), potion_of_unbridled_fury
0:50.949 default M sunfire Fluffy_Pillow 17.5/100: 18% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(5), potion_of_unbridled_fury
0:52.006 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(5), potion_of_unbridled_fury
0:52.905 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(6), potion_of_unbridled_fury
0:54.253 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(4), strife(6), potion_of_unbridled_fury
0:55.152 default P lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(5), strife(6), potion_of_unbridled_fury
0:56.501 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(5), strife(6), potion_of_unbridled_fury
0:57.400 default P lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(6), strife(6), potion_of_unbridled_fury
0:58.747 default Q solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(7), strife(6)
0:59.648 default I cancel_buff Fluffy_Pillow 98.5/100: 99% astral_power lifeblood(4), arcanic_pulsar(5), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(7), strife(6)
0:59.648 default J starsurge Fluffy_Pillow 98.5/100: 99% astral_power lifeblood(4), arcanic_pulsar(5), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(7), strife(6)
1:00.802 default J starsurge Fluffy_Pillow 59.5/100: 60% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(7), strife(6)
1:01.921 default N moonfire Fluffy_Pillow 20.0/100: 20% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(7), strife(6)
1:03.009 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(7), strife(6)
1:04.396 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(7), strife(6)
1:05.324 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), strife(7)
1:06.413 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), strife(7)
1:07.311 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), strife(7)
1:08.658 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(9), strife(7)
1:10.005 default M sunfire Fluffy_Pillow 40.5/100: 41% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(9), strife(7)
1:11.064 default O stellar_flare Fluffy_Pillow 44.0/100: 44% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), strife(7)
1:12.122 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(24), strife(8)
1:12.952 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(24), strife(8)
1:13.784 default P lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(23), strife(8)
1:15.032 default Q solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(21), strife(8)
1:15.871 default J starsurge Fluffy_Pillow 95.5/100: 96% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(21), strife(8)
1:16.857 default Q solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(20), strife(8)
1:17.611 default P lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(19), strife(8)
1:18.712 default I cancel_buff Fluffy_Pillow 93.0/100: 93% astral_power lifeblood(4), celestial_alignment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(18), strife(8)
1:18.712 default J starsurge Fluffy_Pillow 93.0/100: 93% astral_power lifeblood(4), celestial_alignment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(18), strife(8)
1:19.656 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(17), strife(8)
1:20.451 default J starsurge Fluffy_Pillow 66.5/100: 67% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(16), strife(8)
1:21.390 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(15), strife(8)
1:22.168 default L moonfire Fluffy_Pillow 35.5/100: 36% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(2), highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(14), strife(8)
1:23.087 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(13), strife(8)
1:24.413 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(12), strife(8)
1:25.456 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(11), strife(8)
1:26.752 default M sunfire Fluffy_Pillow 25.5/100: 26% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(10), strife(8)
1:27.775 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(9), strife(8)
1:29.082 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(7), strife(8)
1:30.115 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(6), strife(8)
1:31.434 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(24), strife(8)
1:32.264 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(23), strife(8)
1:33.513 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(22), strife(8)
1:34.498 default O stellar_flare Fluffy_Pillow 5.5/100: 6% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(21), strife(8)
1:35.483 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(20), strife(8)
1:36.325 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(19), strife(8)
1:37.590 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(18), strife(8)
1:38.453 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(17), strife(8)
1:39.748 default J starsurge Fluffy_Pillow 57.0/100: 57% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(2), highborne_compendium_of_storms(4), prodigys_potency(13), overwhelming_power(16), strife(8)
1:40.860 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(15), strife(8)
1:41.765 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(14), strife(8)
1:43.124 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(12), strife(8)
1:44.038 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(11), strife(8)
1:45.117 default M sunfire Fluffy_Pillow 13.0/100: 13% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(10), strife(8)
1:46.169 default N moonfire Fluffy_Pillow 16.5/100: 17% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(9), strife(8)
1:47.223 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(8), strife(8)
1:48.123 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(7), strife(8)
1:49.477 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(6), strife(8)
1:50.383 default J starsurge Fluffy_Pillow 54.5/100: 55% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(5), strife(8)
1:51.451 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(4), strife(8)
1:52.339 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(3), strife(8)
1:53.675 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(2), strife(8)
1:55.013 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(14), strife(8)
1:55.930 default P lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(14), strife(8)
1:57.303 default O stellar_flare Fluffy_Pillow 71.0/100: 71% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(14), strife(8)
1:58.381 default Q solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), strife(8)
1:59.279 default I cancel_buff Fluffy_Pillow 88.5/100: 89% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), strife(8)
1:59.279 default J starsurge Fluffy_Pillow 88.5/100: 89% astral_power lifeblood(4), arcanic_pulsar(8), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), strife(8)
2:00.432 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), strife(8)
2:01.260 default J starsurge Fluffy_Pillow 69.5/100: 70% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), strife(8)
2:02.236 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), strife(8)
2:03.042 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), strife(8)
2:03.989 default Q solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), strife(8)
2:04.771 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), strife(8)
2:05.945 default M sunfire Fluffy_Pillow 24.5/100: 25% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), strife(8)
2:07.003 default N moonfire Fluffy_Pillow 28.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), strife(8)
2:08.063 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), strife(8)
2:09.411 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), strife(8)
2:10.472 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), strife(8)
2:11.819 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), overwhelming_power(24), strife(8)
2:13.062 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), overwhelming_power(22), strife(8)
2:13.898 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), overwhelming_power(22), strife(8)
2:14.881 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(16), overwhelming_power(21), strife(8)
2:16.138 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(16), overwhelming_power(19), strife(8)
2:16.982 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(16), overwhelming_power(19), strife(8)
2:18.248 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), overwhelming_power(17), strife(8)
2:19.099 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), overwhelming_power(16), strife(8)
2:19.952 default J starsurge Fluffy_Pillow 68.0/100: 68% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), overwhelming_power(16), strife(8)
2:21.044 default M sunfire Fluffy_Pillow 29.0/100: 29% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), overwhelming_power(14), strife(8)
2:22.112 default O stellar_flare Fluffy_Pillow 32.5/100: 33% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(13), strife(8)
2:23.183 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(25), strife(8)
2:24.213 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(24), strife(8)
2:25.492 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(23), strife(8)
2:26.775 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(22), strife(8)
2:28.063 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(25), strife(8)
2:29.063 default N moonfire Fluffy_Pillow 1.0/100: 1% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(24), strife(8)
2:30.056 default Q solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(23), strife(8)
2:30.889 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(23), strife(8)
2:32.136 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(21), strife(8)
2:32.975 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(21), strife(8)
2:34.232 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(19), strife(8)
2:35.225 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(18), strife(8)
2:36.493 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(17), strife(8)
2:37.343 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(16), strife(8)
2:38.196 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(15), strife(8)
2:39.476 default M sunfire Fluffy_Pillow 59.0/100: 59% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(14), strife(8)
2:40.486 default J starsurge Fluffy_Pillow 66.5/100: 67% astral_power lifeblood(4), arcanic_pulsar(8), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(13), strife(8)
2:41.589 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(12), strife(8)
2:42.384 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(11), strife(8)
2:43.322 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(10), strife(8)
2:44.102 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(9), strife(8)
2:45.291 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(8), strife(8)
2:46.213 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(19), overwhelming_power(7), strife(8)
2:47.136 default L moonfire Fluffy_Pillow 3.0/100: 3% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(19), overwhelming_power(6), strife(8)
2:48.037 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(19), overwhelming_power(5), strife(8)
2:49.362 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(20), overwhelming_power(4), strife(8)
2:50.691 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(20), overwhelming_power(3), strife(8)
2:51.580 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power lifeblood(4), arcanic_pulsar(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(20), overwhelming_power(2), strife(8)
2:52.630 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(20), overwhelming_power, strife(8)
2:53.972 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(20), strife(8)
2:54.870 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(20), strife(8)
2:55.769 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(20), strife(8)
2:56.827 default M sunfire Fluffy_Pillow 48.5/100: 49% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(20), strife(8)
2:57.886 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(20), strife(8)
2:58.944 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(20), strife(8)
3:00.003 default Q solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(20), strife(8)
3:01.062 default J starsurge Fluffy_Pillow 78.5/100: 79% astral_power lifeblood(4), arcanic_pulsar(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(21), strife(8)
3:02.236 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
3:03.688 default G guardian_of_azeroth Fluffy_Pillow 52.0/100: 52% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
3:04.995 default H celestial_alignment Fluffy_Pillow 53.0/100: 53% astral_power lifeblood(4), arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
3:05.971 default E potion Fluffy_Pillow 93.5/100: 94% astral_power lifeblood(4), guardian_of_azeroth, arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
3:05.971 default F berserking Fluffy_Pillow 93.5/100: 94% astral_power lifeblood(4), guardian_of_azeroth, arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8), potion_of_unbridled_fury
3:05.971 default J starsurge Fluffy_Pillow 93.5/100: 94% astral_power berserking, lifeblood(4), guardian_of_azeroth, arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8), potion_of_unbridled_fury
3:06.841 default Q solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power berserking, lifeblood(4), guardian_of_azeroth(2), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8), potion_of_unbridled_fury
3:07.596 default J starsurge Fluffy_Pillow 67.0/100: 67% astral_power berserking, lifeblood(4), guardian_of_azeroth(2), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8), potion_of_unbridled_fury
3:08.424 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power berserking, lifeblood(4), guardian_of_azeroth(3), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8), potion_of_unbridled_fury
3:09.179 default N moonfire Fluffy_Pillow 36.0/100: 36% astral_power berserking, lifeblood(4), guardian_of_azeroth(4), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8), potion_of_unbridled_fury
3:09.956 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8), potion_of_unbridled_fury
3:10.720 default O stellar_flare Fluffy_Pillow 4.0/100: 4% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8), potion_of_unbridled_fury
3:11.481 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8), potion_of_unbridled_fury
3:12.237 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8), potion_of_unbridled_fury
3:13.207 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8), potion_of_unbridled_fury
3:13.963 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8), potion_of_unbridled_fury
3:14.933 default J starsurge Fluffy_Pillow 54.5/100: 55% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8), potion_of_unbridled_fury
3:15.693 default M sunfire Fluffy_Pillow 15.0/100: 15% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8), potion_of_unbridled_fury
3:16.455 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8), potion_of_unbridled_fury
3:17.208 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8), potion_of_unbridled_fury
3:18.177 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8), potion_of_unbridled_fury
3:19.013 default P lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(23), strife(8), potion_of_unbridled_fury
3:20.100 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(23), strife(8), potion_of_unbridled_fury
3:20.951 default P lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(23), strife(8), potion_of_unbridled_fury
3:22.036 default J starsurge Fluffy_Pillow 82.5/100: 83% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, highborne_compendium_of_storms(4), prodigys_potency(23), strife(8), potion_of_unbridled_fury
3:22.965 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(23), strife(8), potion_of_unbridled_fury
3:23.720 default J starsurge Fluffy_Pillow 63.5/100: 64% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(23), strife(8), potion_of_unbridled_fury
3:24.605 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(25), strife(8), potion_of_unbridled_fury
3:25.358 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(24), strife(8), potion_of_unbridled_fury
3:26.369 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(23), strife(8), potion_of_unbridled_fury
3:27.166 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(22), strife(8), potion_of_unbridled_fury
3:27.920 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(22), strife(8), potion_of_unbridled_fury
3:28.910 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(21), strife(8), potion_of_unbridled_fury
3:29.690 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(20), strife(8), potion_of_unbridled_fury
3:30.475 default L moonfire Fluffy_Pillow 8.0/100: 8% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(19), strife(8), potion_of_unbridled_fury
3:31.260 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(18), strife(8), potion_of_unbridled_fury
3:32.412 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(17), strife(8), potion_of_unbridled_fury
3:33.570 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(16), strife(8), potion_of_unbridled_fury
3:34.481 default M sunfire Fluffy_Pillow 5.5/100: 6% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(15), strife(8), potion_of_unbridled_fury
3:35.486 default O stellar_flare Fluffy_Pillow 9.5/100: 10% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(14), strife(8), potion_of_unbridled_fury
3:36.495 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(13), strife(8), potion_of_unbridled_fury
3:37.784 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(12), strife(8), potion_of_unbridled_fury
3:39.100 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(10), strife(8), potion_of_unbridled_fury
3:39.985 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(10), strife(8), potion_of_unbridled_fury
3:40.856 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power lifeblood(4), arcanic_pulsar(4), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(9), strife(8), potion_of_unbridled_fury
3:41.882 default P lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(8), strife(8), potion_of_unbridled_fury
3:43.193 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power lifeblood(4), arcanic_pulsar(4), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(25), overwhelming_power(6), strife(8), potion_of_unbridled_fury
3:44.323 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(25), overwhelming_power(5), strife(8), potion_of_unbridled_fury
3:45.424 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(25), overwhelming_power(4), strife(8), potion_of_unbridled_fury
3:46.792 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), overwhelming_power(3), strife(8), potion_of_unbridled_fury
3:48.163 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), overwhelming_power, strife(8), potion_of_unbridled_fury
3:49.086 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:50.176 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:51.075 default M sunfire Fluffy_Pillow 24.0/100: 24% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:52.132 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:53.478 default N moonfire Fluffy_Pillow 40.5/100: 41% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:54.537 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:55.437 default J starsurge Fluffy_Pillow 56.5/100: 56% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
3:56.496 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
3:57.396 default O stellar_flare Fluffy_Pillow 26.0/100: 26% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
3:58.455 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
3:59.802 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
4:00.701 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
4:01.603 default Q solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
4:02.663 default Q solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
4:03.724 default J starsurge Fluffy_Pillow 82.0/100: 82% astral_power lifeblood(4), arcanic_pulsar(8), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
4:04.878 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
4:05.706 default J starsurge Fluffy_Pillow 63.5/100: 64% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
4:06.680 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8)
4:07.486 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8)
4:08.693 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8)
4:09.636 default K sunfire Fluffy_Pillow 14.0/100: 14% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8)
4:10.556 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(28), strife(8)
4:11.928 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(25), strife(8)
4:12.755 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(24), strife(8)
4:13.730 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(23), strife(8)
4:14.563 default N moonfire Fluffy_Pillow 12.5/100: 13% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), overwhelming_power(22), strife(8)
4:15.546 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(21), strife(8)
4:16.802 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(20), strife(8)
4:18.064 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(18), strife(8)
4:19.060 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(17), strife(8)
4:19.911 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(17), strife(8)
4:21.183 default O stellar_flare Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(15), strife(8)
4:22.188 default Q solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), overwhelming_power(14), strife(8)
4:23.046 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), overwhelming_power(13), strife(8)
4:23.908 default J starsurge Fluffy_Pillow 65.5/100: 66% astral_power lifeblood(4), arcanic_pulsar(4), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), overwhelming_power(13), strife(8)
4:25.011 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), overwhelming_power(11), strife(8)
4:26.386 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), overwhelming_power(10), strife(8)
4:27.306 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power lifeblood(4), arcanic_pulsar(5), starlord, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), overwhelming_power(9), strife(8)
4:28.411 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), overwhelming_power(8), strife(8)
4:29.786 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), overwhelming_power(7), strife(8)
4:30.690 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), overwhelming_power(6), strife(8)
4:31.594 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power lifeblood(4), arcanic_pulsar(6), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(31), overwhelming_power(5), strife(8)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16715 15195 12905
Intellect 1467 -3 12229 10676 8704 (5789)
Spirit 0 0 0 0 0
Health 334300 303900 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 12229 10676 0
Crit 22.17% 20.88% 1143
Haste 24.38% 24.38% 1658
Damage / Heal Versatility 3.13% 3.13% 266
ManaReg per Second 2396 640 0
Attack Power 12718 11103 0
Mastery 37.17% 37.17% 1162
Armor 2828 2828 2828
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 434.00
Local Head Shroud of Unmooring Whispers
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
azerite powers: { Streaking Stars, Arcanic Pulsar, Overwhelming Power }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Shoulderpads of Frothing Rage
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
azerite powers: { Streaking Stars, Loyal to the End, Heed My Call }
Local Chest Tunic of the Sycophant
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
azerite powers: { Streaking Stars, Undulating Tides, Gutripper }
Local Waist Vim's Scalecrusher Clasp
ilevel: 425, stats: { 233 Armor, +358 AgiInt, +637 Sta, +102 Crit, +111 Haste }, gems: { +50 Haste }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Akana's Reefstrider Footwraps
ilevel: 425, stats: { 285 Armor, +358 AgiInt, +637 Sta, +102 Mastery, +111 Haste }, gems: { +50 Haste }
Local Wrists Ori's Tidal Wristwraps
ilevel: 425, stats: { 181 Armor, +268 AgiInt, +478 Sta, +87 Vers, +73 Haste }, gems: { +50 Haste }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Overclocking Bit Band
ilevel: 415, stats: { +430 Sta, +388 Haste, +97 Mastery }, enchant: { +60 Crit }
Local Finger2 Logic Loop of Recursion
ilevel: 415, stats: { +430 Sta, +361 Crit, +124 Haste }, enchant: { +60 Crit }
Local Trinket2 Highborne Compendium of Storms
ilevel: 400, stats: { +359 Int }
Local Back Shirakess Drape
ilevel: 425, stats: { 122 Armor, +268 StrAgiInt, +478 Sta, +83 Haste, +77 Mastery }, gems: { +50 Haste }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="sandbag"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
professions=engineering=100/jewelcrafting=100
talents=1000231
azerite_essences=14:3/32:3/4:3

# Default consumables
potion=unbridled_fury
flask=greater_flask_of_endless_fathoms
food=mechdowels_big_mech
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Azerite variables
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
# Starfall v Starsurge target cutoff
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6
actions+=/berserking,if=buff.ca_inc.up
# CDs
actions+=/use_item,name=azsharas_font_of_power,if=equipped.169314&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/guardian_of_azeroth,if=(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_item,name=pocketsized_computation_device,if=equipped.167555&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/use_item,name=shiver_venom_relic,if=equipped.168905&cooldown.ca_inc.remains>30&!buff.ca_inc.up
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(!talent.stellar_flare.enabled|dot.stellar_flare.remains>10)&!buff.ca_inc.up&(astral_power<25|cooldown.ca_inc.remains>30)
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/focused_azerite_beam
actions+=/thorns
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(buff.memory_of_lucid_dreams.up|ap_check)&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)
actions+=/celestial_alignment,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
# Spenders
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
# DoTs
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
# Generators
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
# Fallthru for movement
actions+=/sunfire

head=shroud_of_unmooring_whispers,id=168349,ilevel=450,azerite_powers=122/200/30
neck=heart_of_azeroth,id=158075,ilevel=463,azerite_level=65
shoulders=shoulderpads_of_frothing_rage,id=168348,ilevel=450,azerite_powers=122/576/22
back=shirakess_drape,id=169486,ilevel=425,gems=50haste
chest=tunic_of_the_sycophant,id=168350,ilevel=450,azerite_powers=122/575/31
wrists=oris_tidal_wristwraps,id=170305,ilevel=425,gems=50haste
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=vims_scalecrusher_clasp,id=170368,ilevel=425,gems=50haste
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=akanas_reefstrider_footwraps,id=170141,ilevel=425,gems=50haste
finger1=overclocking_bit_band,id=169159,ilevel=415,enchant=60crit
finger2=logic_loop_of_recursion,id=169158,ilevel=415,enchant=60crit
trinket2=highborne_compendium_of_storms,id=169328,ilevel=400
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=434.14
# gear_stamina=12905
# gear_intellect=8704
# gear_crit_rating=1143
# gear_haste_rating=1658
# gear_mastery_rating=805
# gear_versatility_rating=266
# gear_armor=2828

shiver : 54678 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
54677.7 54677.7 105.6 / 0.193% 6856.1 / 12.5% 5994.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.7 8.5 Astral Power 0.00% 62.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator
Professions
  • engineering: 100
  • jewelcrafting: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
shiver 54678
Azerite Spike 1014 1.9% 17.7 15.96sec 17090 0 Direct 17.7 13797 28454 17101 22.6%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.69 17.67 0.00 0.00 0.0000 0.0000 302262.06 302262.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.69 77.44% 13797.08 12665 15347 13793.04 13206 14550 188816 188816 0.00
crit 3.99 22.56% 28454.16 26090 31616 27872.63 0 31616 113447 113447 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295835
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:90.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295835
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:{$@spelldesc295834=Your spells and abilities have a high chance to impale your target with a spike of Azerite, causing ${$m1*(1+$@versadmg)} Fire damage.$?a295837[ When an Azerite spike deals damage, all damage you deal against that target is increased by {$295838s1=5}% for {$295838d=6 seconds}.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11696.33
  • base_dd_max:11696.33
  • base_dd_mult:1.00
 
Conch Strike 373 0.7% 13.3 21.21sec 8406 0 Direct 13.1 6840 14095 8483 22.7%  

Stats details: conch_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.26 13.14 0.00 0.00 0.0000 0.0000 111494.25 159277.50 30.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.16 77.33% 6839.58 6415 7067 6840.23 6620 7067 69507 99296 30.00
crit 2.98 22.67% 14094.86 13215 14558 13380.71 0 14558 41987 59981 28.49
 
 

Action details: conch_strike

Static Values
  • id:304698
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:304698
  • name:Conch Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc304697=While in Nazjatar or the Eternal Palace, your spells and abilities have a chance to deal Physical damage and increased threat to enemies in a small area around the target. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8462.82
  • base_dd_max:8462.82
  • base_dd_mult:1.00
 
Frost Blast 579 1.1% 13.3 21.32sec 12989 0 Direct 13.3 10497 21627 12989 22.4%  

Stats details: frost_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.32 13.32 0.00 0.00 0.0000 0.0000 172982.50 172982.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.34 77.61% 10497.48 9623 11661 10496.11 10041 11137 108498 108498 0.00
crit 2.98 22.39% 21626.87 19824 24023 20529.35 0 24023 64484 64484 0.00
 
 

Action details: frost_blast

Static Values
  • id:304645
  • school:frost
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:304645
  • name:Frost Blast
  • school:frost
  • tooltip:Slowed.
  • description:{$@spelldesc304640=While in Nazjatar or the Eternal Palace, your spells and abilities have a chance to deal {$304645s1=0} Frost damage to your target, slowing them for {$304645d=6 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8887.35
  • base_dd_max:8887.35
  • base_dd_mult:1.00
 
Gutripper 526 1.0% 38.3 7.59sec 4089 0 Direct 38.3 3307 6817 4089 22.3%  

Stats details: gutripper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.27 38.27 0.00 0.00 0.0000 0.0000 156487.97 223554.24 30.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.74 77.71% 3306.94 3100 3415 3308.02 3212 3381 98343 140489 30.00
crit 8.53 22.29% 6816.63 6386 7035 6818.15 6543 7035 58145 83065 30.00
 
 

Action details: gutripper

Static Values
  • id:269031
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:269031
  • name:Gutripper
  • school:physical
  • tooltip:
  • description:{$@spelldesc266937=Your damaging abilities have a chance to deal {$s1=1112} Physical damage to the target. Gutripper occurs much more often against targets below {$s2=30}% health. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4090.00
  • base_dd_max:4090.00
  • base_dd_mult:1.00
 
Heed My Call 348 (498) 0.6% (0.9%) 8.8 31.90sec 16943 0 Direct 8.8 9576 19738 11849 22.3%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.79 8.79 0.00 0.00 0.0000 0.0000 104081.81 104081.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.82 77.65% 9575.97 8778 10637 9583.31 9020 10470 65328 65328 0.00
crit 1.96 22.35% 19738.07 18082 21912 16946.90 0 21912 38754 38754 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 150 0.3% 8.8 31.90sec 5096 0 Direct 8.8 4105 8455 5093 22.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.79 8.79 0.00 0.00 0.0000 0.0000 44765.83 44765.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.78 77.22% 4104.51 3762 4559 4099.20 0 4486 27847 27847 0.00
crit 2.00 22.78% 8455.41 7749 9391 7407.66 0 9391 16918 16918 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6276 11.5% 82.1 3.54sec 22831 18735 Direct 82.1 18495 38090 22837 22.1%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.10 82.10 0.00 0.00 1.2186 0.0000 1874351.11 1874351.11 0.00 18734.89 18734.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.93 77.87% 18495.19 10911 22778 18499.55 17857 19172 1182300 1182300 0.00
crit 18.17 22.13% 38089.59 25039 46923 38101.06 35696 41082 692051 692051 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3002 5.5% 14.2 21.27sec 63321 66148 Direct 14.2 3070 6353 3784 21.7%  
Periodic 237.6 2875 5918 3546 22.0% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.15 14.15 237.64 237.64 0.9573 1.2491 896112.93 896112.93 0.00 2887.18 66148.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.08 78.31% 3070.36 2498 3768 3070.28 2843 3343 34023 34023 0.00
crit 3.07 21.69% 6353.05 5146 7762 6142.49 0 7762 19506 19506 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 185.3 77.96% 2874.85 10 3508 2875.56 2801 3018 532556 532556 0.00
crit 52.4 22.04% 5918.48 147 7227 5919.77 5671 6242 310027 310027 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Potion of Unbridled Fury 1416 2.6% 79.1 3.17sec 5281 0 Direct 79.1 4274 8801 5281 22.2%  

Stats details: potion_of_unbridled_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.14 79.14 0.00 0.00 0.0000 0.0000 417907.33 417907.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.53 77.75% 4273.56 3898 4724 4273.37 4107 4517 262953 262953 0.00
crit 17.61 22.25% 8801.39 8030 9731 8798.79 8441 9311 154955 154955 0.00
 
 

Action details: potion_of_unbridled_fury

Static Values
  • id:300717
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:300717
  • name:Potion of Unbridled Fury
  • school:fire
  • tooltip:
  • description:Deal {$s1=3600} Fire damage to your current target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3600.00
  • base_dd_max:3600.00
  • base_dd_mult:1.00
 
Shiver Venom 1259 (1842) 2.3% (3.4%) 56.0 5.25sec 9830 0 Periodic 112.0 2717 5603 3359 22.3% 89.1%

Stats details: shiver_venom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.02 0.00 111.99 111.99 0.0000 2.3782 376203.57 376203.57 0.00 2067.46 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 87.1 77.74% 2716.63 655 3969 2714.22 2137 3095 236480 236480 0.00
crit 24.9 22.26% 5603.06 1350 8177 5595.06 3870 7000 139723 139723 0.00
 
 

Action details: shiver_venom

Static Values
  • id:301624
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:301624
  • name:Shiver Venom
  • school:nature
  • tooltip:Take $w1 Nature damage every $t1 sec.
  • description:Poisons the enemy for {$s1=0} Nature damage every $t1 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:604.72
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:4.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Venomous Shivers 583 1.1% 4.9 62.22sec 35842 0 Direct 4.9 28811 59700 35822 22.8%  

Stats details: venomous_shivers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.87 4.87 0.00 0.00 0.0000 0.0000 174459.25 174459.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.76 77.21% 28810.92 5908 33074 28771.98 17723 33074 108252 108252 0.00
crit 1.11 22.79% 59699.76 23760 68132 42483.66 0 68132 66207 66207 0.00
 
 

Action details: venomous_shivers

Static Values
  • id:305290
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:305290
  • name:Venomous Shivers
  • school:frost
  • tooltip:
  • description:{$@spelldesc301834=Freeze the Shiver Venom on your target, consuming it to deal ${{$301576s1=0}*(1+$@versadmg)} Frost damage per stack to all nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5040.75
  • base_dd_max:5040.75
  • base_dd_mult:1.00
 
Shooting Stars 1099 2.0% 47.6 6.16sec 6896 0 Direct 47.6 5590 11520 6896 22.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.58 47.58 0.00 0.00 0.0000 0.0000 328112.62 328112.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.09 77.97% 5590.26 4522 6820 5591.81 5237 5937 207362 207362 0.00
crit 10.48 22.03% 11519.63 9314 14049 11519.82 10473 12904 120751 120751 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3951 (5703) 7.2% (10.4%) 101.8 2.88sec 16727 19344 Direct 102.3 9344 19233 11536 22.2%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.79 102.27 0.00 0.00 0.8647 0.0000 1179752.04 1179752.04 0.00 19344.01 19344.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.61 77.84% 9344.47 7536 11367 9347.71 8988 9720 743851 743851 0.00
crit 22.66 22.16% 19233.46 15524 23415 19236.69 18157 20879 435901 435901 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (_empowered) 1752 3.2% 79.0 3.69sec 6617 0 Direct 79.0 6617 0 6617 0.0%  

Stats details: solar_wrath_empowered

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.01 79.01 0.00 0.00 0.0000 0.0000 522849.27 522849.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.01 100.00% 6616.94 4555 13347 6619.81 5847 7894 522849 522849 0.00
 
 

Action details: solar_wrath_empowered

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5121.71
  • base_dd_max:5121.71
  • base_dd_mult:1.00
 
Starsurge 14219 26.0% 64.8 4.64sec 65441 66288 Direct 64.6 53070 109300 65654 22.4%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.84 64.63 0.00 0.00 0.9872 0.0000 4242881.01 4242881.01 0.00 66287.77 66287.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.17 77.63% 53070.18 43153 64684 53085.62 51061 55343 2662333 2662333 0.00
crit 14.46 22.37% 109300.39 88895 133248 109316.76 99913 119820 1580548 1580548 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1959 3.6% 12.8 23.55sec 45827 47275 Direct 12.8 2637 5425 3262 22.5%  
Periodic 235.6 1868 3846 2306 22.1% 98.5%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.76 12.76 235.58 235.58 0.9694 1.2493 584794.87 584794.87 0.00 1906.83 47275.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.90 77.54% 2636.76 2154 3248 2638.00 2386 2845 26093 26093 0.00
crit 2.87 22.46% 5424.56 4436 6692 5224.64 0 6692 15545 15545 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 183.4 77.86% 1867.81 265 2274 1868.33 1820 1961 342606 342606 0.00
crit 52.1 22.14% 3846.04 78 4684 3847.11 3685 4049 200551 200551 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Storm of the Eternal 529 1.0% 6.0 120.00sec 26092 0 Direct 6.0 21068 43507 26198 22.8%  

Stats details: storm_of_the_eternal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 5.98 0.00 0.00 0.0000 0.0000 156549.63 156549.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.61 77.16% 21067.91 19370 23473 21069.85 19490 23473 97169 97169 0.00
crit 1.36 22.84% 43507.01 39903 48353 34100.49 0 48353 59381 59381 0.00
 
 

Action details: storm_of_the_eternal

Static Values
  • id:303725
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303725
  • name:Storm of the Eternal
  • school:arcane
  • tooltip:
  • description:{$@spelldesc303733=Storm of the Eternal rises for {$303723d=10 seconds} every {$303722d=120 seconds}, dealing ${{$s1=0}*(1+$@versadmg)} Arcane damage {$303724u=3} times to a random enemy within $303725A1 yds. All Storm of the Eternal effects occur simultaneously.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17887.88
  • base_dd_max:17887.88
  • base_dd_mult:1.00
 
Storms Reckoning 905 1.7% 53.5 5.51sec 5047 0 Direct 53.2 4101 8450 5079 22.5%  

Stats details: storms_reckoning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.54 53.20 0.00 0.00 0.0000 0.0000 270213.37 270213.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.22 77.49% 4100.64 3761 4557 4100.89 3966 4345 169027 169027 0.00
crit 11.97 22.51% 8450.05 7747 9388 8448.33 8050 8950 101186 101186 0.00
 
 

Action details: storms_reckoning

Static Values
  • id:300917
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:15.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:300917
  • name:Storms Reckoning
  • school:nature
  • tooltip:
  • description:{$@spelldesc300913=Your spells have a chance to conjure a typhoon that travels towards enemies dealing {$300917s1=0} Nature damage and grant you $300919s~1 Haste for {$300919d=15 seconds}, up to ${$300919s*{$300919u=4}} Haste. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3473.28
  • base_dd_max:3473.28
  • base_dd_mult:1.00
 
Streaking Star 7082 12.9% 98.0 2.87sec 21447 0 Direct 98.0 17355 35759 21446 22.2%  

Stats details: streaking_star

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.02 98.02 0.00 0.00 0.0000 0.0000 2102177.21 2102177.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.22 77.76% 17354.90 15764 19102 17354.90 16753 18248 1322677 1322677 0.00
crit 21.80 22.24% 35758.70 32473 39351 35756.44 34350 37919 779500 779500 0.00
 
 

Action details: streaking_star

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3335 6.1% 17.6 17.04sec 56601 58595 Direct 17.6 4247 8766 5236 21.9%  
Periodic 236.9 3089 6359 3813 22.2% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.59 17.59 236.90 236.90 0.9660 1.2492 995353.62 995353.62 0.00 3180.73 58595.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.74 78.12% 4246.93 3446 5197 4246.63 3955 4650 58341 58341 0.00
crit 3.85 21.88% 8765.84 7098 10707 8618.44 0 10707 33732 33732 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.4 77.85% 3088.60 15 3768 3089.38 3014 3238 569593 569593 0.00
crit 52.5 22.15% 6359.24 126 7762 6360.79 6061 6648 333687 333687 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Undulating Tides 1783 3.3% 53.5 5.48sec 9956 0 Direct 53.3 8126 16735 9992 21.7%  

Stats details: undulating_tides

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.47 53.27 0.00 0.00 0.0000 0.0000 532378.77 532378.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.71 78.30% 8125.70 7449 9027 8125.95 7882 8446 338904 338904 0.00
crit 11.56 21.70% 16735.26 15345 18595 16734.53 16041 17744 193474 193474 0.00
 
 

Action details: undulating_tides

Static Values
  • id:303389
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303389
  • name:Undulating Tides
  • school:frost
  • tooltip:
  • description:{$@spelldesc303008=Your damaging spells and abilities have a chance to crash a wave upon your target for {$s1=1870} Frost damage. When your health drops below {$s2=50}%, gain a shield absorbing {$s3=14665} damage within {$303390d=8 seconds}. When this occurs, Undulating Tides cannot trigger again for {$s4=45} sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6879.00
  • base_dd_max:6879.00
  • base_dd_mult:1.00
 
pet - guardian_of_azeroth 12484 / 2539
Azerite Spike 11118 4.1% 61.5 3.45sec 10852 11321 Direct 61.5 8900 17803 10854 21.9%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.47 61.47 0.00 0.00 0.9586 0.0000 667087.96 667087.96 0.00 11320.97 11320.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.99 78.08% 8900.01 8233 9070 8900.00 8735 9001 427149 427149 0.00
crit 13.48 21.92% 17803.13 16466 18139 17802.21 17423 18078 239939 239939 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295856
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295856
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:Strike your target with a shard of Azerite, dealing {$s1=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7602.61
  • base_dd_max:7602.61
  • base_dd_mult:1.00
 
Azerite Volley 1366 0.5% 6.0 39.29sec 13664 0 Direct 6.0 11163 22299 13663 22.5%  

Stats details: azerite_volley

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 81982.00 81982.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.65 77.54% 11163.17 10805 11336 11163.64 10888 11336 51938 51938 0.00
crit 1.35 22.46% 22299.31 21610 22672 17530.16 0 22672 30044 30044 0.00
 
 

Action details: azerite_volley

Static Values
  • id:303351
  • school:flamestrike
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303351
  • name:Azerite Volley
  • school:flamestrike
  • tooltip:
  • description:{$@spelldesc295841=Every $303347t1 sec, the Guardian of Azeroth will launch of volley of Azerite Spikes at the target area, dealing {$s1=2287} damage to all enemies near its target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9502.90
  • base_dd_max:9502.90
  • base_dd_mult:1.00
 
Simple Action Stats Execute Interval
shiver
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:shiver
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.79sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.64sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8389 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Greater Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:298837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:shiver
  • harmful:false
  • if_expr:
 
Well Fed (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:297039
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:shiver
  • harmful:false
  • if_expr:
 
Guardian of Azeroth 2.0 180.45sec

Stats details: guardian_of_azeroth

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9780 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: guardian_of_azeroth

Static Values
  • id:295840
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
Spelldata
  • id:295840
  • name:Guardian of Azeroth
  • school:physical
  • tooltip:
  • description:Call upon Azeroth to summon a Guardian of Azeroth for {$300091d=30 seconds} who impales your target with spikes of Azerite every 2 sec that deal ${$295834m1*(1+$@versadmg)} Fire damage.$?a295841[ Every $303347t1 sec, the Guardian launches a volley of Azerite Spikes at its target, dealing {$295841s1=2287} Fire damage to all nearby enemies.][]$?a295843[ Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.][]
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Potion of Unbridled Fury (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:300714
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.7 57.0 41.7sec 4.7sec 93.60% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:shiver
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.15%
  • arcanic_pulsar_2:10.87%
  • arcanic_pulsar_3:12.02%
  • arcanic_pulsar_4:11.49%
  • arcanic_pulsar_5:12.56%
  • arcanic_pulsar_6:10.33%
  • arcanic_pulsar_7:11.74%
  • arcanic_pulsar_8:13.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:shiver
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.8sec 182.8sec 8.13% 12.37% 0.0(0.0) 2.0

Buff details

  • buff initial source:shiver
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.56% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:shiver
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 7.8 0.0 40.3sec 40.3sec 26.90% 34.02% 0.0(0.0) 7.6

Buff details

  • buff initial source:shiver
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Greater Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:shiver
  • cooldown name:buff_greater_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:360.00

Stack Uptimes

  • greater_flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298837
  • name:Greater Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=360} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Guardian of Azeroth 2.0 59.5 180.7sec 3.5sec 19.45% 0.00% 51.5(51.5) 0.0

Buff details

  • buff initial source:shiver
  • cooldown name:buff_guardian_of_azeroth
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • guardian_of_azeroth_1:0.79%
  • guardian_of_azeroth_2:0.71%
  • guardian_of_azeroth_3:0.67%
  • guardian_of_azeroth_4:0.63%
  • guardian_of_azeroth_5:16.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295855
  • name:Guardian of Azeroth
  • tooltip:Haste increased by {$s1=2}%.
  • description:{$@spelldesc295843=Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.}
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Highborne Compendium of Storms 2.8 50.7 98.3sec 5.5sec 97.42% 0.00% 43.1(43.1) 1.8

Buff details

  • buff initial source:shiver
  • cooldown name:buff_highborne_compendium_of_storms
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Highborne Compendium of Storms

Stat Buff details

  • stat:haste_rating
  • amount:64.39

Stack Uptimes

  • highborne_compendium_of_storms_1:4.99%
  • highborne_compendium_of_storms_2:4.52%
  • highborne_compendium_of_storms_3:4.10%
  • highborne_compendium_of_storms_4:83.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:300919
  • name:Highborne Compendium of Storms
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc300913=Your spells have a chance to conjure a typhoon that travels towards enemies dealing {$300917s1=0} Nature damage and grant you $300919s~1 Haste for {$300919d=15 seconds}, up to ${$300919s*{$300919u=4}} Haste. }
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Lifeblood 108.2 0.0 150.5sec 2.7sec 98.46% 0.00% 102.2(110.4) 0.0

Buff details

  • buff initial source:shiver
  • cooldown name:buff_lifeblood
  • max_stacks:4
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:229.17

Stack Uptimes

  • lifeblood_1:1.20%
  • lifeblood_2:1.14%
  • lifeblood_3:1.94%
  • lifeblood_4:94.18%

Trigger Attempt Success

  • trigger_pct:92.30%

Spelldata details

  • id:295137
  • name:Lifeblood
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by ${$w1+$w2+$w3}.
  • description:{$@spelldesc295078=Every {$s4=18}-{$s1=25} sec, a Lifeblood Shard erupts from the nearby ground for {$295114d=12 seconds}.$?!s295186&a295078[ $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within ${$m2*(1+($295160m1/100))} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.][]}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 36.8 48.5 8.2sec 3.5sec 81.28% 99.67% 2.2(2.2) 0.0

Buff details

  • buff initial source:shiver
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.78%
  • lunar_empowerment_2:30.72%
  • lunar_empowerment_3:14.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (mechdowels_big_mech) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:shiver
  • cooldown name:buff_mechdowels_big_mech
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:93.00

Stack Uptimes

  • mechdowels_big_mech_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297039
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=93} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:shiver
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overclocking Bit Band 17.8 0.0 17.3sec 17.3sec 86.99% 0.00% 0.0(0.0) 16.9

Buff details

  • buff initial source:shiver
  • cooldown name:buff_overclocking_bit_band
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:160.00

Stack Uptimes

  • overclocking_bit_band_1:86.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:301886
  • name:Overclocking Bit Band
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc300126=...then you gain {$s1=0} Haste for {$s2=15} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.7 3.8 63.3sec 32.2sec 50.28% 0.00% 3.8(53.3) 0.0

Buff details

  • buff initial source:shiver
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.41%
  • overwhelming_power_2:1.46%
  • overwhelming_power_3:1.49%
  • overwhelming_power_4:1.55%
  • overwhelming_power_5:1.59%
  • overwhelming_power_6:1.64%
  • overwhelming_power_7:1.68%
  • overwhelming_power_8:1.73%
  • overwhelming_power_9:1.79%
  • overwhelming_power_10:1.84%
  • overwhelming_power_11:1.90%
  • overwhelming_power_12:1.95%
  • overwhelming_power_13:2.01%
  • overwhelming_power_14:2.07%
  • overwhelming_power_15:2.14%
  • overwhelming_power_16:2.21%
  • overwhelming_power_17:2.28%
  • overwhelming_power_18:2.35%
  • overwhelming_power_19:2.43%
  • overwhelming_power_20:2.51%
  • overwhelming_power_21:2.59%
  • overwhelming_power_22:2.67%
  • overwhelming_power_23:2.75%
  • overwhelming_power_24:2.83%
  • overwhelming_power_25:1.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Unbridled Fury 2.0 0.0 188.3sec 0.0sec 39.89% 0.00% 0.0(0.0) 1.9

Buff details

  • buff initial source:shiver
  • cooldown name:buff_potion_of_unbridled_fury
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • potion_of_unbridled_fury_1:39.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:300714
  • name:Potion of Unbridled Fury
  • tooltip:Chance to deal an extra {$300717s1=3600} Fire damage to your current target.
  • description:Fill yourself with unbridled energy, giving your offensive spells and attacks a chance to do an additional {$300717s1=3600} Fire damage to your target. Lasts {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Prodigy's Potency 1.0 43.4 0.0sec 6.6sec 98.27% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:shiver
  • cooldown name:buff_prodigys_potency
  • max_stacks:999
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prodigys_potency_1:1.60%
  • prodigys_potency_2:1.52%
  • prodigys_potency_3:1.48%
  • prodigys_potency_4:1.59%
  • prodigys_potency_5:1.78%
  • prodigys_potency_6:1.86%
  • prodigys_potency_7:2.05%
  • prodigys_potency_8:1.99%
  • prodigys_potency_9:2.25%
  • prodigys_potency_10:2.35%
  • prodigys_potency_11:2.50%
  • prodigys_potency_12:2.49%
  • prodigys_potency_13:2.45%
  • prodigys_potency_14:2.48%
  • prodigys_potency_15:2.61%
  • prodigys_potency_16:2.37%
  • prodigys_potency_17:2.55%
  • prodigys_potency_18:2.55%
  • prodigys_potency_19:2.49%
  • prodigys_potency_20:2.38%
  • prodigys_potency_21:2.53%
  • prodigys_potency_22:2.47%
  • prodigys_potency_23:2.41%
  • prodigys_potency_24:2.38%
  • prodigys_potency_25:2.33%
  • prodigys_potency_26:2.32%
  • prodigys_potency_27:2.30%
  • prodigys_potency_28:2.29%
  • prodigys_potency_29:2.27%
  • prodigys_potency_30:2.23%
  • prodigys_potency_31:2.11%
  • prodigys_potency_32:2.27%
  • prodigys_potency_33:2.25%
  • prodigys_potency_34:2.16%
  • prodigys_potency_35:2.06%
  • prodigys_potency_36:1.96%
  • prodigys_potency_37:2.01%
  • prodigys_potency_38:1.92%
  • prodigys_potency_39:1.84%
  • prodigys_potency_40:1.70%
  • prodigys_potency_41:1.44%
  • prodigys_potency_42:1.40%
  • prodigys_potency_43:1.26%
  • prodigys_potency_44:1.11%
  • prodigys_potency_45:0.93%
  • prodigys_potency_46:0.90%
  • prodigys_potency_47:0.72%
  • prodigys_potency_48:0.67%
  • prodigys_potency_49:0.58%
  • prodigys_potency_50:0.50%
  • prodigys_potency_51:0.37%
  • prodigys_potency_52:0.30%
  • prodigys_potency_53:0.26%
  • prodigys_potency_54:0.19%
  • prodigys_potency_55:0.16%
  • prodigys_potency_56:0.11%
  • prodigys_potency_57:0.08%
  • prodigys_potency_58:0.07%
  • prodigys_potency_59:0.06%
  • prodigys_potency_60:0.03%
  • prodigys_potency_61:0.05%
  • prodigys_potency_62:0.04%
  • prodigys_potency_63:0.02%
  • prodigys_potency_64:0.02%
  • prodigys_potency_65:0.01%
  • prodigys_potency_66:0.01%
  • prodigys_potency_67:0.03%
  • prodigys_potency_68:0.01%
  • prodigys_potency_69:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:303017
  • name:Prodigy's Potency
  • tooltip:$w1 damage and healing stored.
  • description:
  • max_stacks:999
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
Solar Empowerment 28.4 52.9 10.5sec 3.7sec 84.00% 77.40% 0.2(0.2) 0.0

Buff details

  • buff initial source:shiver
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.50%
  • solar_empowerment_2:38.10%
  • solar_empowerment_3:15.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 49.6 20.2sec 4.6sec 97.97% 96.98% 19.4(19.4) 11.4

Buff details

  • buff initial source:shiver
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:13.39%
  • starlord_2:21.57%
  • starlord_3:63.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Strife 2.1 52.4 109.3sec 5.4sec 97.79% 0.00% 39.4(39.4) 1.1

Buff details

  • buff initial source:shiver
  • cooldown name:buff_strife
  • max_stacks:8
  • duration:14.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:53.82

Stack Uptimes

  • strife_1:3.82%
  • strife_2:3.73%
  • strife_3:3.74%
  • strife_4:3.45%
  • strife_5:3.45%
  • strife_6:3.26%
  • strife_7:3.08%
  • strife_8:73.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:304056
  • name:Strife
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc304081=Your spells and abilities have a chance to increase your Versatility by {$s1=0} for {$304056d=8 seconds}, stacking up to {$304056u=5} times. Being the vicitim of a loss of control or movement impairing effect also grants a stack of Strife.}
  • max_stacks:5
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.2 1.2 60.8sec 45.0sec 23.50% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:shiver
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.50%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
unempowered_solar_wrath 23.4 12.5sec
unempowered_lunar_strike 0.3 75.3sec
wasted_streaking_star 0.0 0.0sec
arcanic_pulsar_proc 6.7 42.8sec

Resources

Resource Usage Type Count Total Average RPE APR
shiver
starsurge Astral Power 64.8 2593.3 40.0 40.0 1636.1
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 102.79 822.31 (32.18%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.13%) 40.00 0.00 0.00%
sunfire Astral Power 17.59 52.76 (2.06%) 3.00 0.00 0.00%
shooting_stars Astral Power 47.54 190.16 (7.44%) 4.00 0.00 0.00%
moonfire Astral Power 14.15 42.46 (1.66%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.76 102.10 (4.00%) 8.00 0.00 0.00%
lunar_strike Astral Power 82.09 985.09 (38.55%) 12.00 0.05 0.01%
natures_balance Astral Power 399.02 199.51 (7.81%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.75 80.94 (3.17%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.55 8.68
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.12 0.00 43.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data shiver Fight Length
Count 1192
Mean 298.89
Minimum 240.09
Maximum 359.91
Spread ( max - min ) 119.82
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data shiver Damage Per Second
Count 1192
Mean 54677.74
Minimum 49661.41
Maximum 60563.23
Spread ( max - min ) 10901.82
Range [ ( max - min ) / 2 * 100% ] 9.97%
Standard Deviation 1860.2326
5th Percentile 51876.29
95th Percentile 57904.95
( 95th Percentile - 5th Percentile ) 6028.66
Mean Distribution
Standard Deviation 53.8802
95.00% Confidence Intervall ( 54572.13 - 54783.34 )
Normalized 95.00% Confidence Intervall ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4447
0.1 Scale Factor Error with Delta=300 29541
0.05 Scale Factor Error with Delta=300 118163
0.01 Scale Factor Error with Delta=300 2954053
Priority Target DPS
Sample Data shiver Priority Target Damage Per Second
Count 1192
Mean 54677.74
Minimum 49661.41
Maximum 60563.23
Spread ( max - min ) 10901.82
Range [ ( max - min ) / 2 * 100% ] 9.97%
Standard Deviation 1860.2326
5th Percentile 51876.29
95th Percentile 57904.95
( 95th Percentile - 5th Percentile ) 6028.66
Mean Distribution
Standard Deviation 53.8802
95.00% Confidence Intervall ( 54572.13 - 54783.34 )
Normalized 95.00% Confidence Intervall ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4447
0.1 Scale Factor Error with Delta=300 29541
0.05 Scale Factor Error with Delta=300 118163
0.01 Scale Factor Error with Delta=300 2954053
DPS(e)
Sample Data shiver Damage Per Second (Effective)
Count 1192
Mean 54677.74
Minimum 49661.41
Maximum 60563.23
Spread ( max - min ) 10901.82
Range [ ( max - min ) / 2 * 100% ] 9.97%
Damage
Sample Data shiver Damage
Count 1192
Mean 15546171.01
Minimum 12296751.40
Maximum 18801649.16
Spread ( max - min ) 6504897.76
Range [ ( max - min ) / 2 * 100% ] 20.92%
DTPS
Sample Data shiver Damage Taken Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data shiver Healing Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data shiver Healing Per Second (Effective)
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data shiver Heal
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data shiver Healing Taken Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data shiver Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data shiverTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data shiver Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
Azerite variables
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
Starfall v Starsurge target cutoff
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6
F 2.00 berserking,if=buff.ca_inc.up
0.00 use_item,name=azsharas_font_of_power,if=equipped.169314&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
CDs
G 2.00 guardian_of_azeroth,if=(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
0.00 use_item,name=tidestorm_codex,if=equipped.165576
0.00 use_item,name=pocketsized_computation_device,if=equipped.167555&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
H 4.87 use_item,name=shiver_venom_relic,if=equipped.168905&cooldown.ca_inc.remains>30&!buff.ca_inc.up
0.00 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(!talent.stellar_flare.enabled|dot.stellar_flare.remains>10)&!buff.ca_inc.up&(astral_power<25|cooldown.ca_inc.remains>30)
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 focused_azerite_beam
0.00 thorns
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(buff.memory_of_lucid_dreams.up|ap_check)&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)
I 2.00 celestial_alignment,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.91 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
Spenders
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 64.83 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.72 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.69 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.57 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
DoTs
O 11.46 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.76 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
Generators
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 82.48 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 102.04 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.30 sunfire
Fallthru for movement

Sample Sequence

0123456789ACDKONPGIFKRKRQRKRQRQKRNRORQRQKPRQKLHQQKRQQRRRQRKRSKRQRQKKOQPRKRQQKRQNQRRQRKKOQQKRPQQNRRRRRKRQRKRKMHQKQQNQKPRKRQQRRRKQKORNQRKQQRRPRRRJKRKRKRQNKOQQQKQRQRPKQNHRKROQKRQQKRQQRRKNPKRQMQQRKRQRKRQRNRKGQIEFKRKPORQKRQRKRQNRQRQKRKRQKRQRQKHOPQNKQRQRRKQRKRQRRKQNOPQRRRRRKKRQKRQLQKRQOKRQPRRRKQQKQR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask shiver 58.0/100: 58% astral_power
Pre precombat 1 food shiver 58.0/100: 58% astral_power
Pre precombat 2 augmentation shiver 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power potion_of_unbridled_fury
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power potion_of_unbridled_fury
0:01.210 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, potion_of_unbridled_fury
0:02.115 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, strife, potion_of_unbridled_fury
0:03.003 default P stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, overwhelming_power(24), strife, potion_of_unbridled_fury
0:03.821 default G guardian_of_azeroth Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, lifeblood, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, prodigys_potency, overwhelming_power(24), strife, potion_of_unbridled_fury
0:04.639 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, lifeblood, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, prodigys_potency, overwhelming_power(23), strife(2), potion_of_unbridled_fury
0:05.393 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, lifeblood, guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, prodigys_potency, overwhelming_power(22), strife(2), potion_of_unbridled_fury
0:05.393 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, prodigys_potency, overwhelming_power(22), strife(2), potion_of_unbridled_fury
0:06.150 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(2), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, prodigys_potency, overwhelming_power(21), strife(2), potion_of_unbridled_fury
0:06.904 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(3), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, prodigys_potency, overwhelming_power(21), strife(2), potion_of_unbridled_fury
0:07.658 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, lifeblood(2), guardian_of_azeroth(4), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency, overwhelming_power(20), strife(2), potion_of_unbridled_fury
0:08.413 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, lifeblood(2), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency, overwhelming_power(19), strife(2), potion_of_unbridled_fury
0:09.168 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, lifeblood(2), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency, overwhelming_power(18), strife(2), potion_of_unbridled_fury
0:09.923 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(2), overwhelming_power(18), strife(2), potion_of_unbridled_fury
0:10.677 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(2), overwhelming_power(17), strife(2), potion_of_unbridled_fury
0:11.430 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(2), overwhelming_power(16), strife(2), potion_of_unbridled_fury
0:12.185 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(2), overwhelming_power(15), strife(2), potion_of_unbridled_fury
0:12.939 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(2), overwhelming_power(15), strife(2), potion_of_unbridled_fury
0:13.694 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(2), overwhelming_power(14), strife(2), potion_of_unbridled_fury
0:14.448 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(2), overwhelming_power(13), strife(2), potion_of_unbridled_fury
0:15.203 default N sunfire Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(2), overwhelming_power(12), strife(2), potion_of_unbridled_fury
0:15.958 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(2), overwhelming_power(12), strife(2), potion_of_unbridled_fury
0:16.711 default O moonfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), highborne_compendium_of_storms(3), prodigys_potency(2), overwhelming_power(11), strife(2), potion_of_unbridled_fury
0:17.466 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(2), overwhelming_power(10), strife(2), potion_of_unbridled_fury
0:18.219 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), overwhelming_power(9), strife(2), potion_of_unbridled_fury
0:19.016 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(2), overwhelming_power(8), potion_of_unbridled_fury
0:19.772 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), overwhelming_power(8), potion_of_unbridled_fury
0:20.569 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(3), overwhelming_power(7), strife, potion_of_unbridled_fury
0:21.324 default P stellar_flare Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(3), overwhelming_power(6), strife, potion_of_unbridled_fury
0:22.079 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(3), overwhelming_power(5), strife, potion_of_unbridled_fury
0:22.834 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(4), overwhelming_power(5), strife, potion_of_unbridled_fury
0:23.687 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(4), overwhelming_power(4), strife(2), potion_of_unbridled_fury
0:24.442 default L sunfire Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(4), overwhelming_power(3), strife(2), potion_of_unbridled_fury
0:25.198 default H use_item_shiver_venom_relic Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(4), overwhelming_power(2), strife(2), potion_of_unbridled_fury
0:25.198 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(5), overwhelming_power(2), strife(2), potion_of_unbridled_fury
0:26.159 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(5), overwhelming_power, strife(2), potion_of_unbridled_fury
0:27.127 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(5), strife(3), potion_of_unbridled_fury
0:27.890 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(6), strife(3), potion_of_unbridled_fury
0:28.647 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(6), strife(3), potion_of_unbridled_fury
0:29.589 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(6), strife(3), potion_of_unbridled_fury
0:30.533 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(6), strife(4), potion_of_unbridled_fury
0:31.286 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(6), strife(4), potion_of_unbridled_fury
0:32.038 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(6), strife(4), potion_of_unbridled_fury
0:32.793 default Q lunar_strike Fluffy_Pillow 74.5/100: 75% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment, starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(6), strife(4), potion_of_unbridled_fury
0:33.755 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(6), strife(4), potion_of_unbridled_fury
0:34.508 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, lifeblood(4), arcanic_pulsar(8), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(6), strife(4), potion_of_unbridled_fury
0:35.338 default R solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power bloodlust, lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(6), strife(4), potion_of_unbridled_fury
0:36.091 default S sunfire Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, lifeblood(4), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), strife(4), potion_of_unbridled_fury
0:36.845 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, lifeblood(4), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(6), strife(4), potion_of_unbridled_fury
0:37.598 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), strife(4), potion_of_unbridled_fury
0:38.353 default Q lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), strife(4), potion_of_unbridled_fury
0:39.256 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), strife(4), potion_of_unbridled_fury
0:40.011 default Q lunar_strike Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), strife(4), potion_of_unbridled_fury
0:40.914 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), strife(4), potion_of_unbridled_fury
0:41.688 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), strife(4), potion_of_unbridled_fury
0:42.808 default O moonfire Fluffy_Pillow 16.5/100: 17% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), strife(5), potion_of_unbridled_fury
0:43.896 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), strife(5), potion_of_unbridled_fury
0:45.283 default P stellar_flare Fluffy_Pillow 37.0/100: 37% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(5), potion_of_unbridled_fury
0:46.371 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(5), potion_of_unbridled_fury
0:47.298 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(5), potion_of_unbridled_fury
0:48.386 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(5), potion_of_unbridled_fury
0:49.285 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(5), potion_of_unbridled_fury
0:50.632 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(8), strife(6), potion_of_unbridled_fury
0:52.003 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(8), strife(6), potion_of_unbridled_fury
0:53.081 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(6), potion_of_unbridled_fury
0:53.981 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(6), potion_of_unbridled_fury
0:55.328 default N sunfire Fluffy_Pillow 31.5/100: 32% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), overwhelming_power(24), strife(6), potion_of_unbridled_fury
0:56.304 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), overwhelming_power(23), strife(6), potion_of_unbridled_fury
0:57.551 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), overwhelming_power(22), strife(7), potion_of_unbridled_fury
0:58.387 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), overwhelming_power(21), strife(7)
0:59.224 default Q lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), overwhelming_power(20), strife(7)
1:00.485 default R solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power lifeblood(4), arcanic_pulsar(5), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), overwhelming_power(19), strife(8)
1:01.478 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), overwhelming_power(18), strife(8)
1:02.564 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), overwhelming_power(17), strife(8)
1:03.623 default O moonfire Fluffy_Pillow 12.0/100: 12% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), overwhelming_power(16), strife(8)
1:04.655 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), overwhelming_power(25), strife(8)
1:05.928 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(9), overwhelming_power(24), strife(8)
1:07.205 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(22), strife(8)
1:08.232 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(21), strife(8)
1:09.083 default P stellar_flare Fluffy_Pillow 11.0/100: 11% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(20), strife(8)
1:10.073 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(19), strife(8)
1:11.338 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(18), strife(8)
1:12.605 default N sunfire Fluffy_Pillow 45.0/100: 45% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), overwhelming_power(17), strife(8)
1:13.605 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(16), strife(8)
1:14.458 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), overwhelming_power(15), strife(8)
1:15.312 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(14), strife(8)
1:16.321 default R solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(25), strife(8)
1:17.294 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(24), strife(8)
1:18.269 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(23), strife(8)
1:19.248 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(22), strife(8)
1:20.002 default Q lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(21), strife(8)
1:21.095 default R solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(24), strife(8)
1:21.945 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(13), overwhelming_power(24), strife(8)
1:22.871 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(13), overwhelming_power(23), strife(8)
1:23.638 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(13), overwhelming_power(22), strife(8)
1:24.544 default M moonfire Fluffy_Pillow 28.0/100: 28% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), highborne_compendium_of_storms(4), prodigys_potency(13), overwhelming_power(21), strife(8)
1:25.442 default H use_item_shiver_venom_relic Fluffy_Pillow 35.5/100: 36% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(13), overwhelming_power(20), strife(8)
1:25.442 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(13), overwhelming_power(20), strife(8)
1:26.741 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(19), strife(8)
1:27.763 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(18), strife(8)
1:29.033 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(15), overwhelming_power(16), strife(8)
1:30.310 default N sunfire Fluffy_Pillow 35.0/100: 35% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(15), overwhelming_power(15), strife(8)
1:31.315 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(15), overwhelming_power(14), strife(8)
1:32.600 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(15), overwhelming_power(13), strife(8)
1:33.613 default P stellar_flare Fluffy_Pillow 20.0/100: 20% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(15), overwhelming_power(12), strife(8)
1:34.628 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(15), overwhelming_power(11), strife(8)
1:35.494 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(15), overwhelming_power(10), strife(8)
1:36.514 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(15), overwhelming_power(9), strife(8)
1:37.386 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(15), overwhelming_power(8), strife(8)
1:38.698 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(15), overwhelming_power(7), strife(8)
1:40.013 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), overwhelming_power(5), strife(8)
1:40.912 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), overwhelming_power(5), strife(8)
1:41.811 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), overwhelming_power(4), strife(8)
1:42.714 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power lifeblood(4), arcanic_pulsar(5), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), overwhelming_power(3), strife(8)
1:43.876 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), overwhelming_power(2), strife(8)
1:45.293 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), strife(8)
1:46.413 default O moonfire Fluffy_Pillow 0.5/100: 1% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), strife(8)
1:47.501 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), strife(8)
1:48.427 default N sunfire Fluffy_Pillow 21.0/100: 21% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), strife(8)
1:49.516 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), strife(8)
1:50.904 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), strife(8)
1:51.830 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), strife(8)
1:52.918 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), strife(8)
1:54.266 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(16), strife(8)
1:55.613 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(16), strife(8)
1:56.512 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(16), strife(8)
1:57.411 default P stellar_flare Fluffy_Pillow 58.0/100: 58% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
1:58.470 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
1:59.370 default R solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
2:00.429 default R solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
2:01.489 default J cancel_buff Fluffy_Pillow 96.5/100: 97% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
2:01.489 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power lifeblood(4), arcanic_pulsar(8), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
2:02.643 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
2:03.471 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(17), strife(8)
2:04.465 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(17), strife(8)
2:05.287 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(17), strife(8)
2:06.247 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(17), strife(8)
2:07.042 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(17), strife(8)
2:08.231 default N sunfire Fluffy_Pillow 37.0/100: 37% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(17), strife(8)
2:09.304 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(17), strife(8)
2:10.378 default O moonfire Fluffy_Pillow 5.5/100: 6% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(17), strife(8)
2:11.452 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(17), strife(8)
2:12.820 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(19), strife(8)
2:14.187 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), highborne_compendium_of_storms(3), prodigys_potency(19), strife(8)
2:15.570 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(19), strife(8)
2:16.648 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(19), strife(8)
2:18.021 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(20), strife(8)
2:18.938 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife(8)
2:20.285 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(20), strife(8)
2:21.184 default P stellar_flare Fluffy_Pillow 56.0/100: 56% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:22.241 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:23.393 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:24.819 default N sunfire Fluffy_Pillow 38.5/100: 39% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:25.938 default H use_item_shiver_venom_relic Fluffy_Pillow 42.0/100: 42% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:25.938 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(3), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:26.889 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:28.010 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:28.936 default O moonfire Fluffy_Pillow 20.0/100: 20% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8)
2:30.022 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), strife(8)
2:31.411 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), strife(8)
2:32.501 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), strife(8)
2:33.401 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), strife(8)
2:34.750 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), strife(8)
2:36.124 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), strife(8)
2:37.203 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), strife(8)
2:38.120 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), strife(8)
2:39.469 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), strife(8)
2:40.817 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), strife(8)
2:41.715 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), strife(8)
2:42.616 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power lifeblood(4), arcanic_pulsar(8), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), strife(8)
2:43.770 default N sunfire Fluffy_Pillow 29.0/100: 29% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), strife(8)
2:44.746 default P stellar_flare Fluffy_Pillow 32.5/100: 33% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(23), strife(8)
2:45.721 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(25), strife(8)
2:46.617 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(24), strife(8)
2:47.371 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(23), strife(8)
2:48.486 default M moonfire Fluffy_Pillow 23.0/100: 23% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(22), strife(8)
2:49.365 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(21), strife(8)
2:50.658 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(20), strife(8)
2:51.954 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power lifeblood(4), arcanic_pulsar, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(19), strife(8)
2:52.823 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power lifeblood(4), arcanic_pulsar, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(18), strife(8)
2:53.847 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(17), strife(8)
2:54.710 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(16), strife(8)
2:56.009 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(14), strife(8)
2:56.882 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(14), strife(8)
2:57.907 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(13), strife(8)
2:58.769 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(25), overwhelming_power(12), strife(8)
3:00.063 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(25), overwhelming_power(10), strife(8)
3:00.933 default N sunfire Fluffy_Pillow 54.5/100: 55% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(25), overwhelming_power(10), strife(8)
3:01.955 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(25), overwhelming_power(9), strife(8)
3:02.825 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(25), overwhelming_power(8), strife(8)
3:03.947 default G guardian_of_azeroth Fluffy_Pillow 31.5/100: 32% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(25), overwhelming_power(7), strife(8)
3:05.041 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(25), overwhelming_power(5), strife(8)
3:06.443 default I celestial_alignment Fluffy_Pillow 49.0/100: 49% astral_power lifeblood(4), guardian_of_azeroth, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(25), overwhelming_power(4), strife(8)
3:07.385 default E potion Fluffy_Pillow 89.5/100: 90% astral_power lifeblood(4), guardian_of_azeroth(2), arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(25), overwhelming_power(3), strife(8)
3:07.385 default F berserking Fluffy_Pillow 89.5/100: 90% astral_power lifeblood(4), guardian_of_azeroth(2), arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(25), overwhelming_power(3), strife(8), potion_of_unbridled_fury
3:07.385 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power berserking, lifeblood(4), guardian_of_azeroth(2), arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(25), overwhelming_power(3), strife(8), potion_of_unbridled_fury
3:08.230 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power berserking, lifeblood(4), guardian_of_azeroth(3), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(25), overwhelming_power(2), strife(8), potion_of_unbridled_fury
3:08.985 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power berserking, lifeblood(4), guardian_of_azeroth(3), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(25), overwhelming_power(2), strife(8), potion_of_unbridled_fury
3:09.789 default P stellar_flare Fluffy_Pillow 19.5/100: 20% astral_power berserking, lifeblood(4), guardian_of_azeroth(4), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(25), overwhelming_power, strife(8), potion_of_unbridled_fury
3:10.563 default O moonfire Fluffy_Pillow 28.0/100: 28% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(25), strife(8), potion_of_unbridled_fury
3:11.326 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:12.079 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:13.067 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), strife(8), potion_of_unbridled_fury
3:13.828 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), strife(8), potion_of_unbridled_fury
3:14.582 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), strife(8), potion_of_unbridled_fury
3:15.551 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), strife(8), potion_of_unbridled_fury
3:16.305 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), strife(8), potion_of_unbridled_fury
3:17.065 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), strife(8), potion_of_unbridled_fury
3:17.818 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), strife(8), potion_of_unbridled_fury
3:18.788 default N sunfire Fluffy_Pillow 36.5/100: 37% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
3:19.549 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
3:20.386 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), strife(8), potion_of_unbridled_fury
3:21.453 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8), potion_of_unbridled_fury
3:22.291 default Q lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8), potion_of_unbridled_fury
3:23.358 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8), potion_of_unbridled_fury
3:24.272 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8), potion_of_unbridled_fury
3:25.025 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8), potion_of_unbridled_fury
3:25.909 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(28), strife(8), potion_of_unbridled_fury
3:26.664 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), strife(8), potion_of_unbridled_fury
3:27.760 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8), potion_of_unbridled_fury
3:28.620 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(30), strife(8), potion_of_unbridled_fury
3:29.374 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(30), strife(8), potion_of_unbridled_fury
3:30.461 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8), potion_of_unbridled_fury
3:31.215 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8), potion_of_unbridled_fury
3:32.283 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8), potion_of_unbridled_fury
3:33.120 default H use_item_shiver_venom_relic Fluffy_Pillow 13.0/100: 13% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), strife(8), potion_of_unbridled_fury
3:33.120 default O moonfire Fluffy_Pillow 13.0/100: 13% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:34.082 default P stellar_flare Fluffy_Pillow 16.5/100: 17% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:35.139 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:36.484 default N sunfire Fluffy_Pillow 38.0/100: 38% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:37.542 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:38.600 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:39.947 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:40.847 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:42.194 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:43.093 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:43.992 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:45.146 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:46.573 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(3), starlord, highborne_compendium_of_storms(4), prodigys_potency(31), strife(8), potion_of_unbridled_fury
3:47.542 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(2), starlord, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:48.683 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:49.607 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:50.993 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), strife(8), potion_of_unbridled_fury
3:51.918 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:52.844 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:53.932 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:55.280 default N sunfire Fluffy_Pillow 17.5/100: 18% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:56.337 default O moonfire Fluffy_Pillow 21.5/100: 22% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:57.395 default P stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:58.454 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
3:59.801 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
4:00.700 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
4:01.598 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power lifeblood(4), arcanic_pulsar(7), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
4:02.656 default R solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power lifeblood(4), arcanic_pulsar(7), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
4:03.732 default R solar_wrath Fluffy_Pillow 85.0/100: 85% astral_power lifeblood(4), arcanic_pulsar(7), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
4:04.808 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power lifeblood(4), arcanic_pulsar(7), highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
4:05.983 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
4:07.123 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), highborne_compendium_of_storms(4), prodigys_potency(33), strife(8), potion_of_unbridled_fury
4:07.943 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), highborne_compendium_of_storms(4), prodigys_potency(34), strife(8)
4:09.171 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(34), strife(8)
4:10.116 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(34), strife(8)
4:10.897 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(35), strife(8)
4:12.068 default L sunfire Fluffy_Pillow 31.0/100: 31% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(35), overwhelming_power(24), strife(8)
4:12.917 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power lifeblood(4), arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(36), overwhelming_power(24), strife(8)
4:14.160 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power lifeblood(4), arcanic_pulsar, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(36), overwhelming_power(22), strife(8)
4:15.143 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(21), strife(8)
4:15.980 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(21), strife(8)
4:17.235 default O moonfire Fluffy_Pillow 33.0/100: 33% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(19), strife(8)
4:18.227 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(18), strife(8)
4:19.222 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(17), strife(8)
4:20.071 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(16), strife(8)
4:21.347 default P stellar_flare Fluffy_Pillow 27.0/100: 27% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(15), strife(8)
4:22.353 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(14), strife(8)
4:23.213 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(13), strife(8)
4:24.076 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(12), strife(8)
4:25.091 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(11), strife(8)
4:26.221 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(10), strife(8)
4:27.600 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(9), strife(8)
4:28.983 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(8), strife(8)
4:30.073 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(24), strife(8)
4:31.353 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(37), overwhelming_power(23), strife(8)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16715 15195 12905
Intellect 1467 -3 12859 11249 9250 (5789)
Spirit 0 0 0 0 0
Health 334300 303900 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 12859 11249 0
Crit 22.17% 20.88% 1143
Haste 24.38% 24.38% 1658
Damage / Heal Versatility 3.13% 3.13% 266
ManaReg per Second 2396 640 0
Attack Power 13373 11699 0
Mastery 37.17% 37.17% 1162
Armor 2828 2828 2828
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 435.00
Local Head Shroud of Unmooring Whispers
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
azerite powers: { Streaking Stars, Arcanic Pulsar, Overwhelming Power }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Shoulderpads of Frothing Rage
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
azerite powers: { Streaking Stars, Loyal to the End, Heed My Call }
Local Chest Tunic of the Sycophant
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
azerite powers: { Streaking Stars, Undulating Tides, Gutripper }
Local Waist Vim's Scalecrusher Clasp
ilevel: 425, stats: { 233 Armor, +358 AgiInt, +637 Sta, +102 Crit, +111 Haste }, gems: { +50 Haste }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Akana's Reefstrider Footwraps
ilevel: 425, stats: { 285 Armor, +358 AgiInt, +637 Sta, +102 Mastery, +111 Haste }, gems: { +50 Haste }
Local Wrists Ori's Tidal Wristwraps
ilevel: 425, stats: { 181 Armor, +268 AgiInt, +478 Sta, +87 Vers, +73 Haste }, gems: { +50 Haste }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Overclocking Bit Band
ilevel: 415, stats: { +430 Sta, +388 Haste, +97 Mastery }, enchant: { +60 Crit }
Local Finger2 Logic Loop of Recursion
ilevel: 415, stats: { +430 Sta, +361 Crit, +124 Haste }, enchant: { +60 Crit }
Local Trinket1 Shiver Venom Relic
ilevel: 445, stats: { +546 Int }
Local Trinket2 Highborne Compendium of Storms
ilevel: 400, stats: { +359 Int }
Local Back Shirakess Drape
ilevel: 425, stats: { 122 Armor, +268 StrAgiInt, +478 Sta, +83 Haste, +77 Mastery }, gems: { +50 Haste }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="shiver"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
professions=engineering=100/jewelcrafting=100
talents=1000231
azerite_essences=14:3:1/32:3:0/4:3:0

# Default consumables
potion=unbridled_fury
flask=greater_flask_of_endless_fathoms
food=mechdowels_big_mech
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Azerite variables
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
# Starfall v Starsurge target cutoff
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6
actions+=/berserking,if=buff.ca_inc.up
# CDs
actions+=/use_item,name=azsharas_font_of_power,if=equipped.169314&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/guardian_of_azeroth,if=(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_item,name=pocketsized_computation_device,if=equipped.167555&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/use_item,name=shiver_venom_relic,if=equipped.168905&cooldown.ca_inc.remains>30&!buff.ca_inc.up
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(!talent.stellar_flare.enabled|dot.stellar_flare.remains>10)&!buff.ca_inc.up&(astral_power<25|cooldown.ca_inc.remains>30)
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/focused_azerite_beam
actions+=/thorns
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(buff.memory_of_lucid_dreams.up|ap_check)&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)
actions+=/celestial_alignment,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
# Spenders
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
# DoTs
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
# Generators
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
# Fallthru for movement
actions+=/sunfire

head=shroud_of_unmooring_whispers,id=168349,ilevel=450,azerite_powers=122/200/30
neck=heart_of_azeroth,id=158075,ilevel=463,azerite_level=65
shoulders=shoulderpads_of_frothing_rage,id=168348,ilevel=450,azerite_powers=122/576/22
back=shirakess_drape,id=169486,ilevel=425,gems=50haste
chest=tunic_of_the_sycophant,id=168350,ilevel=450,azerite_powers=122/575/31
wrists=oris_tidal_wristwraps,id=170305,ilevel=425,gems=50haste
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=vims_scalecrusher_clasp,id=170368,ilevel=425,gems=50haste
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=akanas_reefstrider_footwraps,id=170141,ilevel=425,gems=50haste
finger1=overclocking_bit_band,id=169159,ilevel=415,enchant=60crit
finger2=logic_loop_of_recursion,id=169158,ilevel=415,enchant=60crit
trinket1=shiver_venom_relic,id=168905,ilevel=445
trinket2=highborne_compendium_of_storms,id=169328,ilevel=400
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=434.87
# gear_stamina=12905
# gear_intellect=9250
# gear_crit_rating=1143
# gear_haste_rating=1658
# gear_mastery_rating=805
# gear_versatility_rating=266
# gear_armor=2828

zaquls : 54325 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
54324.6 54324.6 108.0 / 0.199% 7111.4 / 13.1% 5828.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.9 8.7 Astral Power 0.00% 62.4 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator
Professions
  • engineering: 100
  • jewelcrafting: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
zaquls 54325
Azerite Spike 1043 1.9% 18.3 15.87sec 17077 0 Direct 18.2 13809 28433 17098 22.5%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.25 18.23 0.00 0.00 0.0000 0.0000 311646.99 311646.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.13 77.52% 13808.57 12665 15347 13802.87 13064 14622 195123 195123 0.00
crit 4.10 22.48% 28433.28 26090 31616 28009.26 0 31616 116524 116524 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295835
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:90.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295835
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:{$@spelldesc295834=Your spells and abilities have a high chance to impale your target with a spike of Azerite, causing ${$m1*(1+$@versadmg)} Fire damage.$?a295837[ When an Azerite spike deals damage, all damage you deal against that target is increased by {$295838s1=5}% for {$295838d=6 seconds}.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11696.33
  • base_dd_max:11696.33
  • base_dd_mult:1.00
 
Conch Strike 384 0.7% 13.6 20.93sec 8404 0 Direct 13.5 6843 14092 8475 22.6%  

Stats details: conch_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.64 13.52 0.00 0.00 0.0000 0.0000 114615.16 163735.94 30.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.47 77.45% 6842.98 6415 7067 6844.14 6640 7067 71652 102360 30.00
crit 3.05 22.55% 14091.56 13215 14558 13560.10 0 14558 42963 61376 28.87
 
 

Action details: conch_strike

Static Values
  • id:304698
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:304698
  • name:Conch Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc304697=While in Nazjatar or the Eternal Palace, your spells and abilities have a chance to deal Physical damage and increased threat to enemies in a small area around the target. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8462.82
  • base_dd_max:8462.82
  • base_dd_mult:1.00
 
Frost Blast 590 1.1% 13.6 20.83sec 12993 0 Direct 13.6 10505 21646 12990 22.3%  

Stats details: frost_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.56 13.56 0.00 0.00 0.0000 0.0000 176154.23 176154.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.53 77.67% 10505.21 9623 11661 10504.61 10013 11090 110637 110637 0.00
crit 3.03 22.33% 21645.57 19824 24023 20781.35 0 24023 65517 65517 0.00
 
 

Action details: frost_blast

Static Values
  • id:304645
  • school:frost
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:304645
  • name:Frost Blast
  • school:frost
  • tooltip:Slowed.
  • description:{$@spelldesc304640=While in Nazjatar or the Eternal Palace, your spells and abilities have a chance to deal {$304645s1=0} Frost damage to your target, slowing them for {$304645d=6 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8887.35
  • base_dd_max:8887.35
  • base_dd_mult:1.00
 
Gutripper 540 1.0% 39.3 7.38sec 4086 0 Direct 39.3 3309 6815 4087 22.2%  

Stats details: gutripper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.34 39.34 0.00 0.00 0.0000 0.0000 160726.86 229609.81 30.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.62 77.85% 3309.35 3100 3415 3310.62 3240 3389 101339 144771 30.00
crit 8.71 22.15% 6814.79 6386 7035 6816.48 6592 7035 59387 84839 30.00
 
 

Action details: gutripper

Static Values
  • id:269031
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:269031
  • name:Gutripper
  • school:physical
  • tooltip:
  • description:{$@spelldesc266937=Your damaging abilities have a chance to deal {$s1=1112} Physical damage to the target. Gutripper occurs much more often against targets below {$s2=30}% health. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4090.00
  • base_dd_max:4090.00
  • base_dd_mult:1.00
 
Heed My Call 355 (506) 0.7% (0.9%) 8.9 30.03sec 16902 0 Direct 8.9 9588 19731 11849 22.3%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.95 8.95 0.00 0.00 0.0000 0.0000 106016.12 106016.12 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.95 77.70% 9587.61 8778 10637 9586.36 9029 10637 66654 66654 0.00
crit 1.99 22.30% 19730.68 18082 21912 17080.48 0 21912 39363 39363 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 151 0.3% 8.9 30.03sec 5053 0 Direct 8.9 4108 8460 5056 21.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.95 8.95 0.00 0.00 0.0000 0.0000 45209.50 45209.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.01 78.29% 4108.40 3762 4559 4108.72 3854 4455 28779 28779 0.00
crit 1.94 21.71% 8460.05 7749 9391 7194.01 0 9391 16431 16431 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6457 11.9% 83.8 3.48sec 23030 19336 Direct 83.8 18657 38352 23029 22.2%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.77 83.77 0.00 0.00 1.1911 0.0000 1929306.44 1929306.44 0.00 19336.38 19336.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.17 77.80% 18657.33 11979 35105 18662.81 17712 21037 1216037 1216037 0.00
crit 18.60 22.20% 38351.70 21457 70618 38356.75 34672 43268 713269 713269 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3103 5.7% 14.2 21.17sec 65097 69498 Direct 14.2 3092 6385 3802 21.6%  
Periodic 243.8 2899 5968 3577 22.1% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.23 14.23 243.81 243.81 0.9367 1.2178 926263.33 926263.33 0.00 2985.51 69497.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.16 78.43% 3091.59 2376 5807 3092.91 2813 3478 34506 34506 0.00
crit 3.07 21.57% 6385.17 4894 10875 6145.79 0 9351 19596 19596 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 189.9 77.90% 2898.76 48 5407 2899.51 2766 3167 550544 550544 0.00
crit 53.9 22.10% 5967.66 223 11409 5968.21 5580 6789 321618 321618 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Potion of Unbridled Fury 1455 2.7% 81.5 3.05sec 5275 0 Direct 81.5 4277 8811 5275 22.0%  

Stats details: potion_of_unbridled_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.46 81.46 0.00 0.00 0.0000 0.0000 429689.64 429689.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.54 78.00% 4277.39 3898 4724 4277.39 4124 4461 271796 271796 0.00
crit 17.92 22.00% 8811.34 8030 9731 8812.61 8374 9412 157894 157894 0.00
 
 

Action details: potion_of_unbridled_fury

Static Values
  • id:300717
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:300717
  • name:Potion of Unbridled Fury
  • school:fire
  • tooltip:
  • description:Deal {$s1=3600} Fire damage to your current target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3600.00
  • base_dd_max:3600.00
  • base_dd_mult:1.00
 
Shooting Stars 1132 2.1% 48.6 5.93sec 6949 0 Direct 48.6 5636 11605 6949 22.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.61 48.61 0.00 0.00 0.0000 0.0000 337814.80 337814.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.93 78.01% 5636.40 4300 10511 5637.85 5165 6623 213774 213774 0.00
crit 10.69 21.99% 11605.04 8858 19684 11606.19 10185 14770 124041 124041 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 4108 (5912) 7.6% (10.9%) 105.1 2.79sec 16795 19737 Direct 105.5 9402 19379 11619 22.2%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.09 105.53 0.00 0.00 0.8510 0.0000 1226485.27 1226485.27 0.00 19736.60 19736.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.05 77.75% 9402.01 7167 17945 9405.30 8909 10276 771472 771472 0.00
crit 23.48 22.25% 19379.34 14763 36087 19390.81 17841 21933 455013 455013 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (_empowered) 1804 3.3% 80.7 3.61sec 6671 0 Direct 80.7 6670 0 6670 0.0%  

Stats details: solar_wrath_empowered

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.73 80.73 0.00 0.00 0.0000 0.0000 538578.74 538578.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.73 100.00% 6669.72 4342 20569 6673.42 5769 7616 538579 538579 0.00
 
 

Action details: solar_wrath_empowered

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14619.89
  • base_dd_max:14619.89
  • base_dd_mult:1.00
 
Starsurge 14569 26.9% 66.2 4.54sec 65706 68098 Direct 66.0 53511 110120 65913 21.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.17 65.96 0.00 0.00 0.9649 0.0000 4347918.05 4347918.05 0.00 68097.95 68097.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.51 78.09% 53510.84 41211 97029 53527.97 50775 57462 2756429 2756429 0.00
crit 14.45 21.91% 110120.27 84896 199880 110130.58 99370 132691 1591489 1591489 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 2024 3.7% 12.8 23.55sec 47305 50327 Direct 12.8 2675 5489 3287 21.8%  
Periodic 241.7 1884 3882 2326 22.1% 98.5%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.77 12.77 241.73 241.73 0.9400 1.2181 604171.94 604171.94 0.00 1971.52 50326.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.99 78.23% 2675.34 2048 5006 2675.06 2387 3105 26726 26726 0.00
crit 2.78 21.77% 5489.18 4219 10313 5279.48 0 9005 15264 15264 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 188.3 77.89% 1883.72 8 3590 1884.29 1787 2066 354675 354675 0.00
crit 53.5 22.11% 3882.13 935 7219 3882.97 3610 4375 207506 207506 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Storm of the Eternal 525 1.0% 6.0 120.00sec 25844 0 Direct 6.0 21072 43414 25937 21.8%  

Stats details: storm_of_the_eternal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 5.98 0.00 0.00 0.0000 0.0000 155061.90 155061.90 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.67 78.20% 21071.86 19370 23473 21072.80 19548 23473 98504 98504 0.00
crit 1.30 21.80% 43413.86 39903 48353 33395.62 0 48353 56558 56558 0.00
 
 

Action details: storm_of_the_eternal

Static Values
  • id:303725
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303725
  • name:Storm of the Eternal
  • school:arcane
  • tooltip:
  • description:{$@spelldesc303733=Storm of the Eternal rises for {$303723d=10 seconds} every {$303722d=120 seconds}, dealing ${{$s1=0}*(1+$@versadmg)} Arcane damage {$303724u=3} times to a random enemy within $303725A1 yds. All Storm of the Eternal effects occur simultaneously.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17887.88
  • base_dd_max:17887.88
  • base_dd_mult:1.00
 
Storms Reckoning 920 1.7% 54.6 5.45sec 5032 0 Direct 54.3 4103 8454 5063 22.1%  

Stats details: storms_reckoning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.61 54.28 0.00 0.00 0.0000 0.0000 274825.23 274825.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.30 77.93% 4102.64 3761 4557 4102.89 3959 4304 173556 173556 0.00
crit 11.98 22.07% 8453.57 7747 9388 8450.63 8092 8911 101269 101269 0.00
 
 

Action details: storms_reckoning

Static Values
  • id:300917
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:15.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:300917
  • name:Storms Reckoning
  • school:nature
  • tooltip:
  • description:{$@spelldesc300913=Your spells have a chance to conjure a typhoon that travels towards enemies dealing {$300917s1=0} Nature damage and grant you $300919s~1 Haste for {$300919d=15 seconds}, up to ${$300919s*{$300919u=4}} Haste. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3473.28
  • base_dd_max:3473.28
  • base_dd_mult:1.00
 
Streaking Star 7291 13.4% 101.0 2.78sec 21442 0 Direct 101.0 17365 35780 21442 22.1%  

Stats details: streaking_star

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.97 100.97 0.00 0.00 0.0000 0.0000 2165047.81 2165047.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.62 77.87% 17365.18 15764 19102 17366.61 16803 18191 1365379 1365379 0.00
crit 22.35 22.13% 35779.97 32473 39351 35783.73 34469 37826 799669 799669 0.00
 
 

Action details: streaking_star

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3447 6.4% 17.8 16.77sec 57821 61464 Direct 17.8 4297 8824 5305 22.3%  
Periodic 243.1 3114 6417 3844 22.1% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.79 17.79 243.10 243.10 0.9407 1.2177 1028853.59 1028853.59 0.00 3289.55 61464.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.83 77.71% 4297.13 3277 8010 4297.25 3868 5005 59422 59422 0.00
crit 3.97 22.29% 8824.38 6751 14736 8653.10 0 11865 35000 35000 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 189.4 77.90% 3113.55 22 5807 3114.35 2938 3423 589626 589626 0.00
crit 53.7 22.10% 6416.85 89 12254 6418.43 5999 7286 344806 344806 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Undulating Tides 1835 3.4% 54.8 5.35sec 9999 0 Direct 54.6 8127 16738 10039 22.2%  

Stats details: undulating_tides

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.78 54.57 0.00 0.00 0.0000 0.0000 547752.55 547752.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.46 77.81% 8127.34 7449 9027 8127.67 7912 8460 345098 345098 0.00
crit 12.11 22.19% 16738.47 15345 18595 16741.89 16013 17763 202655 202655 0.00
 
 

Action details: undulating_tides

Static Values
  • id:303389
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303389
  • name:Undulating Tides
  • school:frost
  • tooltip:
  • description:{$@spelldesc303008=Your damaging spells and abilities have a chance to crash a wave upon your target for {$s1=1870} Frost damage. When your health drops below {$s2=50}%, gain a shield absorbing {$s3=14665} damage within {$303390d=8 seconds}. When this occurs, Undulating Tides cannot trigger again for {$s4=45} sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6879.00
  • base_dd_max:6879.00
  • base_dd_mult:1.00
 
pet - guardian_of_azeroth 12750 / 2592
Azerite Spike 11392 4.2% 62.9 3.37sec 10862 11596 Direct 62.9 8900 17807 10862 22.0%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.93 62.93 0.00 0.00 0.9367 0.0000 683528.18 683528.18 0.00 11596.03 11596.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.07 77.97% 8899.88 8233 9070 8899.97 8728 9011 436688 436688 0.00
crit 13.86 22.03% 17806.91 16466 18139 17808.72 17411 18090 246841 246841 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295856
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295856
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:Strike your target with a shard of Azerite, dealing {$s1=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7602.61
  • base_dd_max:7602.61
  • base_dd_mult:1.00
 
Azerite Volley 1358 0.5% 6.0 39.30sec 13580 0 Direct 6.0 11159 22337 13576 21.7%  

Stats details: azerite_volley

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 81482.26 81482.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.70 78.34% 11159.04 10805 11336 11158.39 10871 11336 52454 52454 0.00
crit 1.30 21.66% 22337.23 21610 22672 17487.37 0 22672 29028 29028 0.00
 
 

Action details: azerite_volley

Static Values
  • id:303351
  • school:flamestrike
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303351
  • name:Azerite Volley
  • school:flamestrike
  • tooltip:
  • description:{$@spelldesc295841=Every $303347t1 sec, the Guardian of Azeroth will launch of volley of Azerite Spikes at the target area, dealing {$s1=2287} damage to all enemies near its target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9502.90
  • base_dd_max:9502.90
  • base_dd_mult:1.00
 
Simple Action Stats Execute Interval
zaquls
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:zaquls
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.82sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.68sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8216 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Greater Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:298837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:zaquls
  • harmful:false
  • if_expr:
 
Well Fed (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:297039
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:zaquls
  • harmful:false
  • if_expr:
 
Guardian of Azeroth 2.0 180.48sec

Stats details: guardian_of_azeroth

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9544 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: guardian_of_azeroth

Static Values
  • id:295840
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
Spelldata
  • id:295840
  • name:Guardian of Azeroth
  • school:physical
  • tooltip:
  • description:Call upon Azeroth to summon a Guardian of Azeroth for {$300091d=30 seconds} who impales your target with spikes of Azerite every 2 sec that deal ${$295834m1*(1+$@versadmg)} Fire damage.$?a295841[ Every $303347t1 sec, the Guardian launches a volley of Azerite Spikes at its target, dealing {$295841s1=2287} Fire damage to all nearby enemies.][]$?a295843[ Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.][]
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Potion of Unbridled Fury (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:300714
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.8 58.2 40.9sec 4.6sec 93.90% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:10.40%
  • arcanic_pulsar_2:10.20%
  • arcanic_pulsar_3:11.81%
  • arcanic_pulsar_4:12.40%
  • arcanic_pulsar_5:12.65%
  • arcanic_pulsar_6:9.98%
  • arcanic_pulsar_7:11.02%
  • arcanic_pulsar_8:15.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.13% 12.38% 0.0(0.0) 2.0

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.56% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 7.9 0.0 39.9sec 39.9sec 27.18% 34.24% 0.0(0.0) 7.7

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:27.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Greater Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_greater_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:360.00

Stack Uptimes

  • greater_flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298837
  • name:Greater Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=360} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Guardian of Azeroth 2.0 60.9 180.7sec 3.4sec 19.48% 0.00% 52.9(52.9) 0.0

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_guardian_of_azeroth
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • guardian_of_azeroth_1:0.77%
  • guardian_of_azeroth_2:0.70%
  • guardian_of_azeroth_3:0.66%
  • guardian_of_azeroth_4:0.61%
  • guardian_of_azeroth_5:16.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295855
  • name:Guardian of Azeroth
  • tooltip:Haste increased by {$s1=2}%.
  • description:{$@spelldesc295843=Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.}
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Highborne Compendium of Storms 2.6 52.1 101.5sec 5.4sec 97.64% 0.00% 45.0(45.0) 1.6

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_highborne_compendium_of_storms
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Highborne Compendium of Storms

Stat Buff details

  • stat:haste_rating
  • amount:64.39

Stack Uptimes

  • highborne_compendium_of_storms_1:4.21%
  • highborne_compendium_of_storms_2:3.95%
  • highborne_compendium_of_storms_3:3.86%
  • highborne_compendium_of_storms_4:85.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:300919
  • name:Highborne Compendium of Storms
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc300913=Your spells have a chance to conjure a typhoon that travels towards enemies dealing {$300917s1=0} Nature damage and grant you $300919s~1 Haste for {$300919d=15 seconds}, up to ${$300919s*{$300919u=4}} Haste. }
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Lifeblood 108.5 0.0 150.7sec 2.7sec 98.56% 0.00% 102.3(110.4) 0.0

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_lifeblood
  • max_stacks:4
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:229.17

Stack Uptimes

  • lifeblood_1:1.23%
  • lifeblood_2:1.23%
  • lifeblood_3:1.95%
  • lifeblood_4:94.15%

Trigger Attempt Success

  • trigger_pct:92.43%

Spelldata details

  • id:295137
  • name:Lifeblood
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by ${$w1+$w2+$w3}.
  • description:{$@spelldesc295078=Every {$s4=18}-{$s1=25} sec, a Lifeblood Shard erupts from the nearby ground for {$295114d=12 seconds}.$?!s295186&a295078[ $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within ${$m2*(1+($295160m1/100))} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.][]}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 37.9 49.3 8.0sec 3.4sec 80.92% 99.71% 2.4(2.4) 0.0

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.68%
  • lunar_empowerment_2:29.72%
  • lunar_empowerment_3:15.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (mechdowels_big_mech) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_mechdowels_big_mech
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:93.00

Stack Uptimes

  • mechdowels_big_mech_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297039
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=93} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Overclocking Bit Band 17.8 0.0 17.2sec 17.2sec 87.21% 0.00% 0.0(0.0) 17.0

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_overclocking_bit_band
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:160.00

Stack Uptimes

  • overclocking_bit_band_1:87.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:301886
  • name:Overclocking Bit Band
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc300126=...then you gain {$s1=0} Haste for {$s2=15} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 4.1 63.2sec 31.2sec 50.95% 0.00% 4.1(57.2) 0.0

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.41%
  • overwhelming_power_2:1.45%
  • overwhelming_power_3:1.49%
  • overwhelming_power_4:1.54%
  • overwhelming_power_5:1.59%
  • overwhelming_power_6:1.64%
  • overwhelming_power_7:1.69%
  • overwhelming_power_8:1.74%
  • overwhelming_power_9:1.80%
  • overwhelming_power_10:1.85%
  • overwhelming_power_11:1.91%
  • overwhelming_power_12:1.97%
  • overwhelming_power_13:2.04%
  • overwhelming_power_14:2.10%
  • overwhelming_power_15:2.17%
  • overwhelming_power_16:2.25%
  • overwhelming_power_17:2.32%
  • overwhelming_power_18:2.40%
  • overwhelming_power_19:2.47%
  • overwhelming_power_20:2.56%
  • overwhelming_power_21:2.64%
  • overwhelming_power_22:2.73%
  • overwhelming_power_23:2.83%
  • overwhelming_power_24:2.90%
  • overwhelming_power_25:1.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Unbridled Fury 2.0 0.0 188.1sec 0.0sec 39.88% 0.00% 0.0(0.0) 1.9

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_potion_of_unbridled_fury
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • potion_of_unbridled_fury_1:39.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:300714
  • name:Potion of Unbridled Fury
  • tooltip:Chance to deal an extra {$300717s1=3600} Fire damage to your current target.
  • description:Fill yourself with unbridled energy, giving your offensive spells and attacks a chance to do an additional {$300717s1=3600} Fire damage to your target. Lasts {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Prodigy's Potency 1.0 44.9 0.0sec 6.4sec 98.24% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_prodigys_potency
  • max_stacks:999
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prodigys_potency_1:1.42%
  • prodigys_potency_2:1.42%
  • prodigys_potency_3:1.41%
  • prodigys_potency_4:1.55%
  • prodigys_potency_5:1.65%
  • prodigys_potency_6:1.74%
  • prodigys_potency_7:1.86%
  • prodigys_potency_8:2.06%
  • prodigys_potency_9:2.15%
  • prodigys_potency_10:2.24%
  • prodigys_potency_11:2.35%
  • prodigys_potency_12:2.39%
  • prodigys_potency_13:2.43%
  • prodigys_potency_14:2.38%
  • prodigys_potency_15:2.25%
  • prodigys_potency_16:2.43%
  • prodigys_potency_17:2.42%
  • prodigys_potency_18:2.39%
  • prodigys_potency_19:2.37%
  • prodigys_potency_20:2.37%
  • prodigys_potency_21:2.49%
  • prodigys_potency_22:2.43%
  • prodigys_potency_23:2.32%
  • prodigys_potency_24:2.30%
  • prodigys_potency_25:2.34%
  • prodigys_potency_26:2.22%
  • prodigys_potency_27:2.18%
  • prodigys_potency_28:2.22%
  • prodigys_potency_29:2.21%
  • prodigys_potency_30:2.09%
  • prodigys_potency_31:2.25%
  • prodigys_potency_32:2.14%
  • prodigys_potency_33:2.19%
  • prodigys_potency_34:2.03%
  • prodigys_potency_35:2.06%
  • prodigys_potency_36:2.07%
  • prodigys_potency_37:2.01%
  • prodigys_potency_38:2.04%
  • prodigys_potency_39:1.94%
  • prodigys_potency_40:1.84%
  • prodigys_potency_41:1.76%
  • prodigys_potency_42:1.57%
  • prodigys_potency_43:1.43%
  • prodigys_potency_44:1.36%
  • prodigys_potency_45:1.17%
  • prodigys_potency_46:0.97%
  • prodigys_potency_47:0.91%
  • prodigys_potency_48:0.79%
  • prodigys_potency_49:0.66%
  • prodigys_potency_50:0.60%
  • prodigys_potency_51:0.53%
  • prodigys_potency_52:0.42%
  • prodigys_potency_53:0.37%
  • prodigys_potency_54:0.31%
  • prodigys_potency_55:0.21%
  • prodigys_potency_56:0.15%
  • prodigys_potency_57:0.14%
  • prodigys_potency_58:0.11%
  • prodigys_potency_59:0.07%
  • prodigys_potency_60:0.07%
  • prodigys_potency_61:0.06%
  • prodigys_potency_62:0.04%
  • prodigys_potency_63:0.05%
  • prodigys_potency_64:0.04%
  • prodigys_potency_65:0.03%
  • prodigys_potency_66:0.02%
  • prodigys_potency_67:0.02%
  • prodigys_potency_68:0.00%
  • prodigys_potency_69:0.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:303017
  • name:Prodigy's Potency
  • tooltip:$w1 damage and healing stored.
  • description:
  • max_stacks:999
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
Solar Empowerment 30.3 52.8 9.9sec 3.6sec 82.97% 76.60% 0.2(0.2) 0.0

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.97%
  • solar_empowerment_2:37.35%
  • solar_empowerment_3:14.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 50.8 20.1sec 4.5sec 98.04% 97.03% 20.6(20.6) 11.0

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:12.87%
  • starlord_2:20.89%
  • starlord_3:64.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Strife 2.1 52.4 110.7sec 5.4sec 97.79% 0.00% 39.5(39.5) 1.1

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_strife
  • max_stacks:8
  • duration:14.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:53.82

Stack Uptimes

  • strife_1:3.72%
  • strife_2:3.66%
  • strife_3:3.62%
  • strife_4:3.33%
  • strife_5:3.35%
  • strife_6:3.18%
  • strife_7:3.17%
  • strife_8:73.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:304056
  • name:Strife
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc304081=Your spells and abilities have a chance to increase your Versatility by {$s1=0} for {$304056d=8 seconds}, stacking up to {$304056u=5} times. Being the vicitim of a loss of control or movement impairing effect also grants a stack of Strife.}
  • max_stacks:5
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.6sec 46.0sec 23.63% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.63%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Void Negotiation 8.1 0.0 34.0sec 32.7sec 24.01% 0.00% 0.0(0.0) 6.2

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_void_negotiation
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:2355.64

Stack Uptimes

  • void_negotiation_1:21.32%
  • void_negotiation_2:2.48%
  • void_negotiation_3:0.21%
  • void_negotiation_4:0.02%
  • void_negotiation_5:0.00%

Trigger Attempt Success

  • trigger_pct:99.25%

Spelldata details

  • id:302960
  • name:Void Negotiation
  • tooltip:Intellect increased by $w1.
  • description:Standing near the Void portal increases your Intellect by {$s1=0}.
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
unempowered_solar_wrath 24.9 11.8sec
unempowered_lunar_strike 0.2 77.4sec
wasted_streaking_star 0.0 0.0sec
arcanic_pulsar_proc 6.9 41.9sec

Resources

Resource Usage Type Count Total Average RPE APR
zaquls
starsurge Astral Power 66.2 2646.9 40.0 40.0 1642.6
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 106.10 848.79 (32.54%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.07%) 40.00 0.00 0.00%
sunfire Astral Power 17.80 53.39 (2.05%) 3.00 0.00 0.00%
shooting_stars Astral Power 48.62 194.45 (7.45%) 4.00 0.01 0.00%
moonfire Astral Power 14.23 42.69 (1.64%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.77 102.19 (3.92%) 8.00 0.00 0.00%
lunar_strike Astral Power 83.77 1005.14 (38.53%) 12.00 0.07 0.01%
natures_balance Astral Power 399.02 199.51 (7.65%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.89 82.64 (3.17%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.73 8.86
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 18.36 0.00 63.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data zaquls Fight Length
Count 1192
Mean 298.89
Minimum 240.09
Maximum 359.91
Spread ( max - min ) 119.82
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data zaquls Damage Per Second
Count 1192
Mean 54324.62
Minimum 49005.67
Maximum 60951.13
Spread ( max - min ) 11945.46
Range [ ( max - min ) / 2 * 100% ] 10.99%
Standard Deviation 1903.3016
5th Percentile 51446.99
95th Percentile 57595.93
( 95th Percentile - 5th Percentile ) 6148.94
Mean Distribution
Standard Deviation 55.1277
95.00% Confidence Intervall ( 54216.57 - 54432.67 )
Normalized 95.00% Confidence Intervall ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4716
0.1 Scale Factor Error with Delta=300 30925
0.05 Scale Factor Error with Delta=300 123697
0.01 Scale Factor Error with Delta=300 3092424
Priority Target DPS
Sample Data zaquls Priority Target Damage Per Second
Count 1192
Mean 54324.62
Minimum 49005.67
Maximum 60951.13
Spread ( max - min ) 11945.46
Range [ ( max - min ) / 2 * 100% ] 10.99%
Standard Deviation 1903.3016
5th Percentile 51446.99
95th Percentile 57595.93
( 95th Percentile - 5th Percentile ) 6148.94
Mean Distribution
Standard Deviation 55.1277
95.00% Confidence Intervall ( 54216.57 - 54432.67 )
Normalized 95.00% Confidence Intervall ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4716
0.1 Scale Factor Error with Delta=300 30925
0.05 Scale Factor Error with Delta=300 123697
0.01 Scale Factor Error with Delta=300 3092424
DPS(e)
Sample Data zaquls Damage Per Second (Effective)
Count 1192
Mean 54324.62
Minimum 49005.67
Maximum 60951.13
Spread ( max - min ) 11945.46
Range [ ( max - min ) / 2 * 100% ] 10.99%
Damage
Sample Data zaquls Damage
Count 1192
Mean 15426138.17
Minimum 12240923.29
Maximum 19453246.26
Spread ( max - min ) 7212322.98
Range [ ( max - min ) / 2 * 100% ] 23.38%
DTPS
Sample Data zaquls Damage Taken Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data zaquls Healing Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data zaquls Healing Per Second (Effective)
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data zaquls Heal
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data zaquls Healing Taken Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data zaquls Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data zaqulsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data zaquls Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
Azerite variables
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
Starfall v Starsurge target cutoff
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6
F 2.00 berserking,if=buff.ca_inc.up
0.00 use_item,name=azsharas_font_of_power,if=equipped.169314&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
CDs
G 2.00 guardian_of_azeroth,if=(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
0.00 use_item,name=tidestorm_codex,if=equipped.165576
0.00 use_item,name=pocketsized_computation_device,if=equipped.167555&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
0.00 use_item,name=shiver_venom_relic,if=equipped.168905&cooldown.ca_inc.remains>30&!buff.ca_inc.up
0.00 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(!talent.stellar_flare.enabled|dot.stellar_flare.remains>10)&!buff.ca_inc.up&(astral_power<25|cooldown.ca_inc.remains>30)
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 focused_azerite_beam
0.00 thorns
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(buff.memory_of_lucid_dreams.up|ap_check)&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)
H 2.00 celestial_alignment,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 3.41 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
Spenders
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 66.17 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 3.05 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 2.70 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 14.36 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
DoTs
N 11.53 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.77 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
Generators
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 84.16 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 105.35 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.39 sunfire
Fallthru for movement

Sample Sequence

0123456789ACDJNMOGHFJQJQPQJQPQPJQMQNQPQPJOJQPKJPPPQQQQQQJQPQJQPQLIJPJMOPPJQPQJQPPQQPQJJMNPQPJOQPPQQJQPIJQJQKNPJPPPJQOPQQMQQIJPJPPJNQPQJQPPMPOQQJQJQJQPLPJPPJMPQQPQQJOJPQPJNQMPPJQPQQQQJQJQOQPJMPNPJPQQQQQQQJJGPMPOHEFJQPJNQPQPQJQPQJQJQMQPJQPJQPOJQLPPQPPQJJMQPJQPPPJQPNOQQQMQJQJQJQPKPJPPQQJPNPOQJPQQJPQP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask zaquls 58.0/100: 58% astral_power
Pre precombat 1 food zaquls 58.0/100: 58% astral_power
Pre precombat 2 augmentation zaquls 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power potion_of_unbridled_fury
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power potion_of_unbridled_fury
0:01.180 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, potion_of_unbridled_fury
0:02.062 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, prodigys_potency, potion_of_unbridled_fury
0:02.929 default O stellar_flare Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, prodigys_potency(2), potion_of_unbridled_fury
0:03.796 default G guardian_of_azeroth Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, prodigys_potency(2), potion_of_unbridled_fury
0:04.663 default H celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(3), potion_of_unbridled_fury
0:05.417 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(3), potion_of_unbridled_fury
0:05.417 default J starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(3), potion_of_unbridled_fury
0:06.170 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(2), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(3), potion_of_unbridled_fury
0:06.923 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(3), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(3), potion_of_unbridled_fury
0:07.677 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(4), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(3), potion_of_unbridled_fury
0:08.430 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(3), potion_of_unbridled_fury
0:09.183 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(3), potion_of_unbridled_fury
0:09.938 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, berserking, lifeblood, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(3), potion_of_unbridled_fury
0:10.691 default Q solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power bloodlust, berserking, lifeblood(2), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms, prodigys_potency(4), potion_of_unbridled_fury
0:11.446 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power bloodlust, berserking, lifeblood(2), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(2), prodigys_potency(4), strife, potion_of_unbridled_fury
0:12.202 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, berserking, lifeblood(2), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(4), strife, potion_of_unbridled_fury
0:12.957 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, berserking, lifeblood(2), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(4), strife, potion_of_unbridled_fury
0:13.711 default J starsurge Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, berserking, lifeblood(2), guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(5), strife, potion_of_unbridled_fury
0:14.467 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, lifeblood(2), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(6), strife, potion_of_unbridled_fury
0:15.221 default M sunfire Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(6), strife, potion_of_unbridled_fury
0:15.975 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, lifeblood(3), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(6), strife, potion_of_unbridled_fury
0:16.728 default N moonfire Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), highborne_compendium_of_storms(3), prodigys_potency(6), strife, potion_of_unbridled_fury
0:17.482 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(6), strife, potion_of_unbridled_fury
0:18.238 default P lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(6), strife, potion_of_unbridled_fury
0:19.044 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(3), prodigys_potency(7), strife, potion_of_unbridled_fury
0:19.799 default P lunar_strike Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), strife, potion_of_unbridled_fury
0:20.602 default J starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), strife(2), potion_of_unbridled_fury
0:21.356 default O stellar_flare Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), strife(2), potion_of_unbridled_fury
0:22.112 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), strife(2), potion_of_unbridled_fury
0:22.866 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), strife(2), potion_of_unbridled_fury
0:23.620 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(7), strife(2), potion_of_unbridled_fury
0:24.444 default K sunfire Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(8), strife(2), potion_of_unbridled_fury
0:25.200 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), strife(2), potion_of_unbridled_fury
0:25.954 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), strife(2), potion_of_unbridled_fury
0:26.876 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), strife(2), potion_of_unbridled_fury
0:27.797 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), strife(2), potion_of_unbridled_fury
0:28.718 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), strife(2), potion_of_unbridled_fury
0:29.473 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), strife(2), potion_of_unbridled_fury
0:30.227 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), strife(3), potion_of_unbridled_fury
0:30.980 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), strife(3), potion_of_unbridled_fury
0:31.735 default Q solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), strife(3), potion_of_unbridled_fury
0:32.489 default Q solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), strife(3), potion_of_unbridled_fury
0:33.243 default J starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment, starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), strife(3), potion_of_unbridled_fury
0:33.998 default Q solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), strife(3), potion_of_unbridled_fury
0:34.752 default P lunar_strike Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, lifeblood(4), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(8), strife(3), potion_of_unbridled_fury
0:35.633 default Q solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power bloodlust, lifeblood(4), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(9), strife(3), potion_of_unbridled_fury
0:36.386 default J starsurge Fluffy_Pillow 93.0/100: 93% astral_power bloodlust, lifeblood(4), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(9), strife(3), potion_of_unbridled_fury
0:37.141 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(9), strife(3), potion_of_unbridled_fury
0:37.896 default P lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(10), strife(4), potion_of_unbridled_fury
0:38.777 default Q solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(10), strife(4), potion_of_unbridled_fury
0:39.533 default L moonfire Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(10), strife(4), potion_of_unbridled_fury
0:40.290 default I cancel_buff Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, lifeblood(3), arcanic_pulsar, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), strife(4), potion_of_unbridled_fury
0:40.290 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, lifeblood(3), arcanic_pulsar, lunar_empowerment(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(10), strife(4), potion_of_unbridled_fury
0:41.156 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power lifeblood(3), arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord, overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(10), strife(4), potion_of_unbridled_fury
0:42.550 default J starsurge Fluffy_Pillow 64.0/100: 64% astral_power lifeblood(3), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(10), strife(4), potion_of_unbridled_fury
0:43.643 default M sunfire Fluffy_Pillow 25.0/100: 25% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(10), strife(4), potion_of_unbridled_fury
0:44.707 default O stellar_flare Fluffy_Pillow 32.5/100: 33% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(10), strife(4), potion_of_unbridled_fury
0:45.770 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power lifeblood(3), arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(10), strife(4), potion_of_unbridled_fury
0:47.122 default P lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(10), strife(4), potion_of_unbridled_fury
0:48.474 default J starsurge Fluffy_Pillow 67.0/100: 67% astral_power lifeblood(2), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), void_negotiation, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(10), strife(5), potion_of_unbridled_fury
0:49.556 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power lifeblood(3), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(10), strife(5), potion_of_unbridled_fury
0:50.434 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(10), strife(5), potion_of_unbridled_fury
0:51.750 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(10), strife(6), potion_of_unbridled_fury
0:52.627 default J starsurge Fluffy_Pillow 58.0/100: 58% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(10), strife(6), potion_of_unbridled_fury
0:53.661 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(10), strife(6), potion_of_unbridled_fury
0:54.540 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(11), strife(7), potion_of_unbridled_fury
0:55.856 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(11), strife(7), potion_of_unbridled_fury
0:57.172 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(11), strife(7), potion_of_unbridled_fury
0:58.050 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(11), strife(8)
0:58.928 default P lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(11), strife(8)
1:00.242 default Q solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power lifeblood(4), arcanic_pulsar(5), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(11), strife(8)
1:01.275 default J starsurge Fluffy_Pillow 91.5/100: 92% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(11), strife(8)
1:02.402 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(11), strife(8)
1:03.495 default M sunfire Fluffy_Pillow 13.0/100: 13% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:04.577 default N moonfire Fluffy_Pillow 17.0/100: 17% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:05.658 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:07.012 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:07.915 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:09.267 default J starsurge Fluffy_Pillow 59.0/100: 59% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:10.329 default O stellar_flare Fluffy_Pillow 19.5/100: 20% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(11), strife(8)
1:11.364 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:12.243 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:13.559 default P lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:14.874 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:15.752 default Q solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:16.631 default J starsurge Fluffy_Pillow 92.0/100: 92% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:17.665 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:18.427 default P lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power lifeblood(4), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), strife(8)
1:19.573 default I cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(24), strife(8)
1:19.573 default J starsurge Fluffy_Pillow 90.0/100: 90% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(24), strife(8)
1:20.478 default Q solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(23), strife(8)
1:21.241 default J starsurge Fluffy_Pillow 63.0/100: 63% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(22), strife(8)
1:22.140 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(21), strife(8)
1:22.897 default K sunfire Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(2), highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(21), strife(8)
1:23.774 default N moonfire Fluffy_Pillow 35.5/100: 36% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(20), strife(8)
1:24.767 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(3), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(12), overwhelming_power(19), strife(8)
1:26.037 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(13), overwhelming_power(17), strife(8)
1:27.041 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(13), overwhelming_power(16), strife(8)
1:28.289 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(15), strife(8)
1:29.541 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(14), strife(8)
1:30.796 default J starsurge Fluffy_Pillow 55.5/100: 56% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(13), strife(8)
1:31.786 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(12), strife(8)
1:32.630 default O stellar_flare Fluffy_Pillow 28.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(11), strife(8)
1:33.625 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(10), strife(8)
1:34.899 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(9), strife(8)
1:35.751 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(8), strife(8)
1:36.605 default M sunfire Fluffy_Pillow 67.0/100: 67% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(7), strife(8)
1:37.614 default Q solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(6), strife(8)
1:38.473 default Q solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(5), strife(8)
1:39.506 default I cancel_buff Fluffy_Pillow 96.0/100: 96% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(4), strife(8)
1:39.506 default J starsurge Fluffy_Pillow 96.0/100: 96% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(4), strife(8)
1:40.636 default P lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power(3), strife(8)
1:42.013 default J starsurge Fluffy_Pillow 70.0/100: 70% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), overwhelming_power, strife(8)
1:43.102 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(14), strife(8)
1:44.455 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(15), strife(8)
1:45.809 default J starsurge Fluffy_Pillow 56.5/100: 56% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(16), strife(8)
1:46.872 default N moonfire Fluffy_Pillow 21.0/100: 21% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(17), strife(8)
1:47.905 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife(8)
1:48.783 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife(8)
1:50.098 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), strife(8)
1:50.976 default J starsurge Fluffy_Pillow 54.5/100: 55% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(25), strife(8)
1:51.930 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(24), strife(8)
1:52.743 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(23), strife(8)
1:53.965 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(22), strife(8)
1:55.187 default M sunfire Fluffy_Pillow 49.5/100: 50% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(20), strife(8)
1:56.171 default P lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(19), strife(8)
1:57.405 default O stellar_flare Fluffy_Pillow 70.0/100: 70% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(18), strife(8)
1:58.378 default Q solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(17), strife(8)
1:59.209 default Q solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(16), strife(8)
2:00.043 default J starsurge Fluffy_Pillow 96.0/100: 96% astral_power lifeblood(4), arcanic_pulsar(8), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(15), strife(8)
2:01.114 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(14), strife(8)
2:01.888 default J starsurge Fluffy_Pillow 77.0/100: 77% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(14), strife(8)
2:02.795 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(13), strife(8)
2:03.549 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(18), overwhelming_power(12), strife(8)
2:04.436 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(11), strife(8)
2:05.190 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(10), strife(8)
2:06.297 default L moonfire Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(9), strife(8)
2:07.170 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(8), strife(8)
2:08.451 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(7), strife(8)
2:09.461 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(19), overwhelming_power(6), strife(8)
2:10.751 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(21), overwhelming_power(5), strife(8)
2:12.066 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(21), overwhelming_power(3), strife(8)
2:13.106 default M sunfire Fluffy_Pillow 3.5/100: 4% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(21), overwhelming_power(2), strife(8)
2:14.149 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), overwhelming_power, strife(8)
2:15.461 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:16.340 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:17.220 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:18.537 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power lifeblood(4), arcanic_pulsar(4), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:19.572 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power lifeblood(4), arcanic_pulsar(4), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:20.607 default J starsurge Fluffy_Pillow 71.5/100: 72% astral_power lifeblood(4), arcanic_pulsar(4), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:21.732 default O stellar_flare Fluffy_Pillow 32.0/100: 32% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:22.826 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:23.918 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:25.271 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:26.174 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:27.527 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment(2), starlord(2), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:28.589 default N moonfire Fluffy_Pillow 5.0/100: 5% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:29.639 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(21), strife(8)
2:30.532 default M sunfire Fluffy_Pillow 17.0/100: 17% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8)
2:31.583 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8)
2:32.898 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8)
2:34.211 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(2), starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8)
2:35.244 default Q solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8)
2:36.121 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8)
2:37.436 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8)
2:38.316 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8)
2:39.194 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8)
2:40.228 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8)
2:41.262 default J starsurge Fluffy_Pillow 71.5/100: 72% astral_power lifeblood(4), arcanic_pulsar(8), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8)
2:42.388 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), strife(8)
2:43.197 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), overwhelming_power(24), strife(8)
2:44.078 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), overwhelming_power(23), strife(8)
2:44.831 default O stellar_flare Fluffy_Pillow 21.5/100: 22% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(22), overwhelming_power(23), strife(8)
2:45.689 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(22), strife(8)
2:46.547 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(21), strife(8)
2:47.646 default J starsurge Fluffy_Pillow 55.5/100: 56% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(20), strife(8)
2:48.512 default M sunfire Fluffy_Pillow 16.0/100: 16% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(19), strife(8)
2:49.482 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(18), strife(8)
2:50.721 default N moonfire Fluffy_Pillow 32.5/100: 33% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(17), strife(8)
2:51.699 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(16), strife(8)
2:52.946 default J starsurge Fluffy_Pillow 49.0/100: 49% astral_power lifeblood(4), arcanic_pulsar(2), solar_empowerment, starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(15), strife(8)
2:53.927 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(14), strife(8)
2:55.183 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment(2), starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(12), strife(8)
2:56.028 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment, starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(11), strife(8)
2:56.876 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(11), strife(8)
2:57.872 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(10), strife(8)
2:58.872 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(9), strife(8)
2:59.874 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(8), strife(8)
3:00.879 default Q solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(7), strife(8)
3:01.904 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power lifeblood(4), arcanic_pulsar(3), highborne_compendium_of_storms(4), prodigys_potency(23), overwhelming_power(6), strife(8)
3:03.026 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(4), strife(8)
3:04.123 default G guardian_of_azeroth Fluffy_Pillow 8.5/100: 9% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(3), strife(8)
3:05.193 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power(2), strife(8)
3:06.536 default M sunfire Fluffy_Pillow 22.0/100: 22% astral_power lifeblood(4), guardian_of_azeroth, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), overwhelming_power, strife(8)
3:07.573 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power lifeblood(4), guardian_of_azeroth(2), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(24), strife(8)
3:08.875 default O stellar_flare Fluffy_Pillow 38.5/100: 39% astral_power lifeblood(4), guardian_of_azeroth(3), arcanic_pulsar(5), solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(25), strife(8)
3:09.879 default H celestial_alignment Fluffy_Pillow 47.5/100: 48% astral_power lifeblood(4), guardian_of_azeroth(4), arcanic_pulsar(5), celestial_alignment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(25), strife(8)
3:10.735 default E potion Fluffy_Pillow 88.0/100: 88% astral_power lifeblood(4), guardian_of_azeroth(4), arcanic_pulsar(5), celestial_alignment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(25), strife(8)
3:10.735 default F berserking Fluffy_Pillow 88.0/100: 88% astral_power lifeblood(4), guardian_of_azeroth(4), arcanic_pulsar(5), celestial_alignment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(25), strife(8), potion_of_unbridled_fury
3:10.735 default J starsurge Fluffy_Pillow 88.0/100: 88% astral_power berserking, lifeblood(4), guardian_of_azeroth(4), arcanic_pulsar(5), celestial_alignment, solar_empowerment(2), starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(25), strife(8), potion_of_unbridled_fury
3:11.514 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(25), strife(8), potion_of_unbridled_fury
3:12.267 default P lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(25), strife(8), potion_of_unbridled_fury
3:13.212 default J starsurge Fluffy_Pillow 69.5/100: 70% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(25), strife(8), potion_of_unbridled_fury
3:13.967 default N moonfire Fluffy_Pillow 30.0/100: 30% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:14.722 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:15.476 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:16.423 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:17.178 default P lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:18.126 default Q solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:18.880 default J starsurge Fluffy_Pillow 92.5/100: 93% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:19.636 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:20.390 default P lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(26), strife(8), potion_of_unbridled_fury
3:21.354 default Q solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(27), overwhelming_power(25), strife(8), potion_of_unbridled_fury
3:22.109 default J starsurge Fluffy_Pillow 82.5/100: 83% astral_power berserking, lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment, highborne_compendium_of_storms(4), prodigys_potency(27), overwhelming_power(24), strife(8), potion_of_unbridled_fury
3:22.870 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(27), overwhelming_power(24), strife(8), potion_of_unbridled_fury
3:23.624 default J starsurge Fluffy_Pillow 63.5/100: 64% astral_power lifeblood(4), guardian_of_azeroth(5), celestial_alignment, lunar_empowerment(2), starlord, overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(27), overwhelming_power(23), strife(8), potion_of_unbridled_fury
3:24.428 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(27), overwhelming_power(22), strife(8), potion_of_unbridled_fury
3:25.182 default M sunfire Fluffy_Pillow 32.5/100: 33% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(27), overwhelming_power(21), strife(8), potion_of_unbridled_fury
3:25.966 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), overwhelming_power(21), strife(8), potion_of_unbridled_fury
3:26.751 default P lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), overwhelming_power(20), strife(8), potion_of_unbridled_fury
3:27.752 default J starsurge Fluffy_Pillow 61.5/100: 62% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), overwhelming_power(19), strife(8), potion_of_unbridled_fury
3:28.541 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), overwhelming_power(18), strife(8), potion_of_unbridled_fury
3:29.296 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(27), overwhelming_power(17), strife(8), potion_of_unbridled_fury
3:30.278 default J starsurge Fluffy_Pillow 51.0/100: 51% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(28), overwhelming_power(16), strife(8), potion_of_unbridled_fury
3:31.052 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(28), overwhelming_power(15), strife(8), potion_of_unbridled_fury
3:31.805 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(28), overwhelming_power(15), strife(8), potion_of_unbridled_fury
3:32.796 default O stellar_flare Fluffy_Pillow 32.5/100: 33% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(28), overwhelming_power(14), strife(8), potion_of_unbridled_fury
3:33.578 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power lifeblood(4), guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(28), overwhelming_power(13), strife(8), potion_of_unbridled_fury
3:34.360 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power lifeblood(4), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(28), overwhelming_power(12), strife(8), potion_of_unbridled_fury
3:35.115 default L moonfire Fluffy_Pillow 10.0/100: 10% astral_power lifeblood(4), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(28), overwhelming_power(11), strife(8), potion_of_unbridled_fury
3:35.983 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(28), overwhelming_power(11), strife(8), potion_of_unbridled_fury
3:37.251 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(28), overwhelming_power(9), strife(8), potion_of_unbridled_fury
3:38.550 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(28), overwhelming_power(8), strife(8), potion_of_unbridled_fury
3:39.419 default P lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), void_negotiation, highborne_compendium_of_storms(4), torrent_of_elements, prodigys_potency(28), overwhelming_power(7), strife(8), potion_of_unbridled_fury
3:40.726 default P lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(28), overwhelming_power(25), strife(8), potion_of_unbridled_fury
3:41.958 default Q solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(28), overwhelming_power(24), strife(8), potion_of_unbridled_fury
3:42.783 default J starsurge Fluffy_Pillow 82.5/100: 83% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(28), overwhelming_power(23), strife(8), potion_of_unbridled_fury
3:43.846 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(28), overwhelming_power(22), strife(8), potion_of_unbridled_fury
3:44.861 default M sunfire Fluffy_Pillow 11.5/100: 12% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(21), strife(8), potion_of_unbridled_fury
3:45.852 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(20), strife(8), potion_of_unbridled_fury
3:46.697 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(19), strife(8), potion_of_unbridled_fury
3:47.967 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(18), strife(8), potion_of_unbridled_fury
3:48.969 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(17), strife(8), potion_of_unbridled_fury
3:49.799 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(16), strife(8), potion_of_unbridled_fury
3:51.048 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(14), strife(8), potion_of_unbridled_fury
3:52.304 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power lifeblood(4), arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(13), strife(8), potion_of_unbridled_fury
3:53.564 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power lifeblood(4), arcanic_pulsar(7), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(12), strife(8), potion_of_unbridled_fury
3:54.556 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(11), strife(8), potion_of_unbridled_fury
3:55.402 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power lifeblood(4), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(10), strife(8), potion_of_unbridled_fury
3:56.674 default N moonfire Fluffy_Pillow 38.5/100: 39% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(9), strife(8), potion_of_unbridled_fury
3:57.678 default O stellar_flare Fluffy_Pillow 42.0/100: 42% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(8), strife(8), potion_of_unbridled_fury
3:58.683 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment(2), starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(7), strife(8), potion_of_unbridled_fury
3:59.542 default Q solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power lifeblood(4), arcanic_pulsar(8), solar_empowerment, starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(29), overwhelming_power(6), strife(8), potion_of_unbridled_fury
4:00.401 default Q solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(30), overwhelming_power(5), strife(8), potion_of_unbridled_fury
4:01.416 default M sunfire Fluffy_Pillow 80.5/100: 81% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(30), overwhelming_power(4), strife(8), potion_of_unbridled_fury
4:02.435 default Q solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power lifeblood(4), arcanic_pulsar(8), starlord(3), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(30), overwhelming_power(3), strife(8), potion_of_unbridled_fury
4:03.458 default J starsurge Fluffy_Pillow 93.0/100: 93% astral_power lifeblood(4), arcanic_pulsar(8), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(30), overwhelming_power(25), strife(8), potion_of_unbridled_fury
4:04.495 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(30), overwhelming_power(24), strife(8), potion_of_unbridled_fury
4:05.250 default J starsurge Fluffy_Pillow 74.5/100: 75% astral_power lifeblood(4), celestial_alignment, lunar_empowerment, starlord, overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(30), overwhelming_power(23), strife(8), potion_of_unbridled_fury
4:06.132 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(30), overwhelming_power(22), strife(8), potion_of_unbridled_fury
4:06.886 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power lifeblood(4), arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overclocking_bit_band, void_negotiation, highborne_compendium_of_storms(4), prodigys_potency(30), overwhelming_power(22), strife(8), potion_of_unbridled_fury
4:07.747 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), overwhelming_power(21), strife(8), potion_of_unbridled_fury
4:08.501 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), overwhelming_power(20), strife(8), potion_of_unbridled_fury
4:09.571 default K sunfire Fluffy_Pillow 25.0/100: 25% astral_power lifeblood(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), overwhelming_power(19), strife(8), potion_of_unbridled_fury
4:10.416 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), overwhelming_power(18), strife(8), potion_of_unbridled_fury
4:11.656 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power lifeblood(4), arcanic_pulsar(2), lunar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), overwhelming_power(17), strife(8)
4:12.633 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(30), overwhelming_power(16), strife(8)
4:13.881 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(15), strife(8)
4:15.155 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power lifeblood(4), arcanic_pulsar(3), solar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(13), strife(8)
4:16.011 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power lifeblood(4), arcanic_pulsar(3), starlord(3), highborne_compendium_of_storms(4), prodigys_potency(31), overwhelming_power(12), strife(8)
4:17.021 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power lifeblood(4), arcanic_pulsar(3), lunar_empowerment, starlord(3), highborne_compendium_of_storms(4), prodigys_potency(32), overwhelming_power(11), strife(8)
4:18.033 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), overwhelming_power(10), strife(8)
4:19.306 default N moonfire Fluffy_Pillow 18.5/100: 19% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), overwhelming_power(9), strife(8)
4:20.310 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power lifeblood(4), arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), overwhelming_power(8), strife(8)
4:21.591 default O stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), overwhelming_power(7), strife(8)
4:22.600 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment(2), starlord(3), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), overwhelming_power(6), strife(8)
4:23.460 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power lifeblood(4), arcanic_pulsar(4), solar_empowerment, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), overwhelming_power(5), strife(8)
4:24.567 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power lifeblood(4), arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(32), overwhelming_power(4), strife(8)
4:25.941 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment(2), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), overwhelming_power(3), strife(8)
4:26.860 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power lifeblood(4), arcanic_pulsar(5), solar_empowerment, starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), overwhelming_power(2), strife(8)
4:27.783 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power lifeblood(4), arcanic_pulsar(5), starlord, overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), overwhelming_power, strife(8)
4:28.873 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8)
4:30.226 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power lifeblood(4), arcanic_pulsar(6), solar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8)
4:31.130 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power lifeblood(4), arcanic_pulsar(6), lunar_empowerment, starlord(2), overclocking_bit_band, highborne_compendium_of_storms(4), prodigys_potency(33), strife(8)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16715 15195 12905
Intellect 1467 -3 12229 10676 8704 (5789)
Spirit 0 0 0 0 0
Health 334300 303900 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 12229 10676 0
Crit 22.17% 20.88% 1143
Haste 27.59% 27.59% 1876
Damage / Heal Versatility 3.13% 3.13% 266
ManaReg per Second 2417 640 0
Attack Power 12718 11103 0
Mastery 37.17% 37.17% 1162
Armor 2828 2828 2828
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 435.00
Local Head Shroud of Unmooring Whispers
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
azerite powers: { Streaking Stars, Arcanic Pulsar, Overwhelming Power }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Shoulderpads of Frothing Rage
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
azerite powers: { Streaking Stars, Loyal to the End, Heed My Call }
Local Chest Tunic of the Sycophant
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
azerite powers: { Streaking Stars, Undulating Tides, Gutripper }
Local Waist Vim's Scalecrusher Clasp
ilevel: 425, stats: { 233 Armor, +358 AgiInt, +637 Sta, +102 Crit, +111 Haste }, gems: { +50 Haste }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Akana's Reefstrider Footwraps
ilevel: 425, stats: { 285 Armor, +358 AgiInt, +637 Sta, +102 Mastery, +111 Haste }, gems: { +50 Haste }
Local Wrists Ori's Tidal Wristwraps
ilevel: 425, stats: { 181 Armor, +268 AgiInt, +478 Sta, +87 Vers, +73 Haste }, gems: { +50 Haste }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Overclocking Bit Band
ilevel: 415, stats: { +430 Sta, +388 Haste, +97 Mastery }, enchant: { +60 Crit }
Local Finger2 Logic Loop of Recursion
ilevel: 415, stats: { +430 Sta, +361 Crit, +124 Haste }, enchant: { +60 Crit }
Local Trinket1 Za'qul's Portal Key
ilevel: 445, stats: { +218 Haste }
Local Trinket2 Highborne Compendium of Storms
ilevel: 400, stats: { +359 Int }
Local Back Shirakess Drape
ilevel: 425, stats: { 122 Armor, +268 StrAgiInt, +478 Sta, +83 Haste, +77 Mastery }, gems: { +50 Haste }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="zaquls"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
professions=engineering=100/jewelcrafting=100
talents=1000231
azerite_essences=14:3:1/32:3:0/4:3:0

# Default consumables
potion=unbridled_fury
flask=greater_flask_of_endless_fathoms
food=mechdowels_big_mech
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Azerite variables
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
# Starfall v Starsurge target cutoff
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6
actions+=/berserking,if=buff.ca_inc.up
# CDs
actions+=/use_item,name=azsharas_font_of_power,if=equipped.169314&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/guardian_of_azeroth,if=(!talent.starlord.enabled|buff.starlord.up)&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_item,name=pocketsized_computation_device,if=equipped.167555&dot.moonfire.ticking&dot.sunfire.ticking&(!talent.stellar_flare.enabled|dot.stellar_flare.ticking)
actions+=/use_item,name=shiver_venom_relic,if=equipped.168905&cooldown.ca_inc.remains>30&!buff.ca_inc.up
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(!talent.stellar_flare.enabled|dot.stellar_flare.remains>10)&!buff.ca_inc.up&(astral_power<25|cooldown.ca_inc.remains>30)
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/focused_azerite_beam
actions+=/thorns
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(buff.memory_of_lucid_dreams.up|ap_check)&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)
actions+=/celestial_alignment,if=!buff.ca_inc.up&(buff.memory_of_lucid_dreams.up|((cooldown.memory_of_lucid_dreams.remains>20|!essence.memory_of_lucid_dreams.major)&ap_check&astral_power>=40))&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
# Spenders
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
# DoTs
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
# Generators
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
# Fallthru for movement
actions+=/sunfire

head=shroud_of_unmooring_whispers,id=168349,ilevel=450,azerite_powers=122/200/30
neck=heart_of_azeroth,id=158075,ilevel=463,azerite_level=65
shoulders=shoulderpads_of_frothing_rage,id=168348,ilevel=450,azerite_powers=122/576/22
back=shirakess_drape,id=169486,ilevel=425,gems=50haste
chest=tunic_of_the_sycophant,id=168350,ilevel=450,azerite_powers=122/575/31
wrists=oris_tidal_wristwraps,id=170305,ilevel=425,gems=50haste
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=vims_scalecrusher_clasp,id=170368,ilevel=425,gems=50haste
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=akanas_reefstrider_footwraps,id=170141,ilevel=425,gems=50haste
finger1=overclocking_bit_band,id=169159,ilevel=415,enchant=60crit
finger2=logic_loop_of_recursion,id=169158,ilevel=415,enchant=60crit
trinket1=zaquls_portal_key,id=169306,ilevel=445
trinket2=highborne_compendium_of_storms,id=169328,ilevel=400
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=434.87
# gear_stamina=12905
# gear_intellect=8704
# gear_crit_rating=1143
# gear_haste_rating=1876
# gear_mastery_rating=805
# gear_versatility_rating=266
# gear_armor=2828

Simulation & Raid Information

Iterations: 1200
Threads: 8
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 298.9 )

Performance:

Total Events Processed: 38173971
Max Event Queue: 490
Sim Seconds: 358663
CPU Seconds: 313.6406
Physical Seconds: 40.0998
Speed Up: 1144

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
azsharas azsharas augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
azsharas azsharas azerite_spike 295835 309290 1035 3.54 13809 28410 17.7 17.6 25.5% 0.0% 0.0% 0.0% 16.18sec 309290 298.89sec
azsharas azsharas berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.58sec 0 298.89sec
azsharas azsharas celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.44sec 0 298.89sec
azsharas azsharas conch_strike 304698 111671 374 2.59 6841 14085 13.0 12.9 24.8% 0.0% 0.0% 0.0% 22.20sec 159530 298.89sec
azsharas azsharas flask 298837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
azsharas azsharas food 297039 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
azsharas azsharas frost_blast 304645 175159 586 2.64 10507 21604 13.2 13.2 25.3% 0.0% 0.0% 0.0% 21.69sec 175159 298.89sec
azsharas azsharas guardian_of_azeroth 295840 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.36sec 0 298.89sec
azsharas azsharas gutripper 269031 159301 533 7.65 3308 6814 38.1 38.1 25.0% 0.0% 0.0% 0.0% 7.68sec 227573 298.89sec
azsharas azsharas heed_my_call 271685 105887 354 1.75 9587 19742 8.7 8.7 25.5% 0.0% 0.0% 0.0% 32.04sec 105887 298.89sec
azsharas azsharas heed_my_call_aoe 271686 45169 151 1.75 4105 8481 8.7 8.7 24.9% 0.0% 0.0% 0.0% 32.04sec 45169 298.89sec
azsharas azsharas latent_arcana 296971 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 120.33sec 0 298.89sec
azsharas azsharas lunar_strike 194153 1950135 6525 16.05 19191 39484 80.0 80.0 25.6% 0.0% 0.0% 0.0% 3.65sec 1950135 298.89sec
azsharas azsharas moonfire 8921 57577 193 2.82 3247 6672 14.1 14.1 24.8% 0.0% 0.0% 0.0% 21.41sec 958193 298.89sec
azsharas azsharas moonfire ticks -8921 900617 3002 47.47 2993 6168 14.1 237.4 25.2% 0.0% 0.0% 0.0% 21.41sec 958193 298.89sec
azsharas azsharas moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
azsharas azsharas potion 300714 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
azsharas azsharas potion_of_unbridled_fury 300717 426900 1428 15.79 4275 8805 78.7 78.7 25.4% 0.0% 0.0% 0.0% 3.13sec 426900 298.89sec
azsharas azsharas shooting_stars 202497 349630 1170 9.52 5818 11980 47.4 47.4 25.2% 0.0% 0.0% 0.0% 6.25sec 349630 298.89sec
azsharas azsharas solar_wrath 190984 1190078 3982 19.50 9662 19917 97.7 97.1 25.3% 0.0% 0.0% 0.0% 3.00sec 1190078 298.89sec
azsharas azsharas solar_wrath_empowered 279729 541230 1811 15.43 7043 0 76.9 76.9 0.0% 0.0% 0.0% 0.0% 3.78sec 541230 298.89sec
azsharas azsharas starsurge 78674 4398903 14718 12.62 55251 113875 63.0 62.8 25.2% 0.0% 0.0% 0.0% 4.76sec 4398903 298.89sec
azsharas azsharas stellar_flare 202347 44029 147 2.56 2727 5580 12.7 12.7 25.5% 0.0% 0.0% 0.0% 23.57sec 621993 298.89sec
azsharas azsharas stellar_flare ticks -202347 577964 1927 47.02 1941 3994 12.7 235.1 25.2% 0.0% 0.0% 0.0% 23.57sec 621993 298.89sec
azsharas azsharas storm_of_the_eternal 303725 158489 530 1.20 21060 43334 6.0 6.0 24.5% 0.0% 0.0% 0.0% 120.00sec 158489 298.89sec
azsharas azsharas storms_reckoning 300917 275204 921 10.62 4101 8449 53.2 52.9 25.3% 0.0% 0.0% 0.0% 5.48sec 275204 298.89sec
azsharas azsharas streaking_star 272873 2077611 6951 18.96 17378 35814 94.5 94.5 25.1% 0.0% 0.0% 0.0% 2.97sec 2077611 298.89sec
azsharas azsharas sunfire 93402 98320 329 3.49 4462 9218 17.4 17.4 25.3% 0.0% 0.0% 0.0% 17.20sec 1059981 298.89sec
azsharas azsharas sunfire ticks -93402 961661 3206 47.30 3213 6613 17.4 236.5 25.1% 0.0% 0.0% 0.0% 17.20sec 1059981 298.89sec
azsharas azsharas undulating_tides 303389 550188 1841 10.73 8122 16745 53.6 53.4 25.2% 0.0% 0.0% 0.0% 5.55sec 550188 298.89sec
azsharas azsharas_guardian_of_azeroth azerite_spike 295856 682203 11370 61.19 8899 17800 61.2 61.2 25.3% 0.0% 0.0% 0.0% 3.46sec 682203 60.00sec
azsharas azsharas_guardian_of_azeroth azerite_volley 303351 84048 1401 6.00 11160 22310 6.0 6.0 25.5% 0.0% 0.0% 0.0% 39.27sec 84048 60.00sec
cyclotronic cyclotronic augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
cyclotronic cyclotronic azerite_spike 295835 308277 1031 3.54 13887 28609 17.7 17.6 24.4% 0.0% 0.0% 0.0% 15.57sec 308277 298.89sec
cyclotronic cyclotronic berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.26sec 0 298.89sec
cyclotronic cyclotronic celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.14sec 0 298.89sec
cyclotronic cyclotronic conch_strike 304698 114071 382 2.63 6883 14180 13.2 13.1 24.9% 0.0% 0.0% 0.0% 22.15sec 162958 298.89sec
cyclotronic cyclotronic cyclotronic_blast ticks -293491 657648 2192 3.52 29461 60690 2.9 17.6 25.4% 0.0% 0.0% 0.0% 121.36sec 657648 298.89sec
cyclotronic cyclotronic flask 298837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
cyclotronic cyclotronic food 297039 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
cyclotronic cyclotronic frost_blast 304645 175855 588 2.65 10565 21742 13.2 13.2 24.5% 0.0% 0.0% 0.0% 21.46sec 175855 298.89sec
cyclotronic cyclotronic guardian_of_azeroth 295840 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.35sec 0 298.89sec
cyclotronic cyclotronic gutripper 269031 160026 535 7.68 3328 6859 38.2 38.2 24.3% 0.0% 0.0% 0.0% 7.56sec 228609 298.89sec
cyclotronic cyclotronic heed_my_call 271685 104530 350 1.74 9635 19843 8.7 8.7 23.9% 0.0% 0.0% 0.0% 32.18sec 104530 298.89sec
cyclotronic cyclotronic heed_my_call_aoe 271686 44964 150 1.74 4128 8515 8.7 8.7 24.4% 0.0% 0.0% 0.0% 32.18sec 44964 298.89sec
cyclotronic cyclotronic lunar_strike 194153 1782263 5963 15.98 17768 36620 79.6 79.6 24.6% 0.0% 0.0% 0.0% 3.62sec 1782263 298.89sec
cyclotronic cyclotronic moonfire 8921 52252 175 2.81 2949 6074 14.0 14.0 25.0% 0.0% 0.0% 0.0% 21.54sec 878265 298.89sec
cyclotronic cyclotronic moonfire ticks -8921 826013 2753 47.47 2760 5687 14.0 237.4 24.6% 0.0% 0.0% 0.0% 21.54sec 878265 298.89sec
cyclotronic cyclotronic moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
cyclotronic cyclotronic potion 300714 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
cyclotronic cyclotronic potion_of_unbridled_fury 300717 425095 1422 15.74 4297 8855 78.4 78.4 24.7% 0.0% 0.0% 0.0% 3.21sec 425095 298.89sec
cyclotronic cyclotronic shooting_stars 202497 318585 1066 9.46 5370 11049 47.1 47.1 24.5% 0.0% 0.0% 0.0% 6.32sec 318585 298.89sec
cyclotronic cyclotronic solar_wrath 190984 1112627 3723 19.73 8992 18505 97.8 98.3 24.5% 0.0% 0.0% 0.0% 2.98sec 1112627 298.89sec
cyclotronic cyclotronic solar_wrath_empowered 279729 499051 1670 15.41 6501 0 76.8 76.8 0.0% 0.0% 0.0% 0.0% 3.76sec 499051 298.89sec
cyclotronic cyclotronic starsurge 78674 4070579 13619 12.63 51263 105645 63.1 62.9 24.7% 0.0% 0.0% 0.0% 4.73sec 4070579 298.89sec
cyclotronic cyclotronic stellar_flare 202347 40341 135 2.56 2512 5172 12.7 12.7 24.5% 0.0% 0.0% 0.0% 23.58sec 571843 298.89sec
cyclotronic cyclotronic stellar_flare ticks -202347 531502 1772 47.04 1793 3694 12.7 235.2 24.6% 0.0% 0.0% 0.0% 23.58sec 571843 298.89sec
cyclotronic cyclotronic storm_of_the_eternal 303725 160219 536 1.20 21190 43629 6.0 6.0 25.0% 0.0% 0.0% 0.0% 120.00sec 160219 298.89sec
cyclotronic cyclotronic storms_reckoning 300917 276830 926 10.66 4125 8498 53.4 53.1 24.9% 0.0% 0.0% 0.0% 5.54sec 276830 298.89sec
cyclotronic cyclotronic streaking_star 272873 2081114 6963 18.98 17473 35993 94.6 94.6 24.5% 0.0% 0.0% 0.0% 2.94sec 2081114 298.89sec
cyclotronic cyclotronic sunfire 93402 88951 298 3.49 4056 8346 17.4 17.4 24.8% 0.0% 0.0% 0.0% 17.16sec 974125 298.89sec
cyclotronic cyclotronic sunfire ticks -93402 885174 2951 47.31 2964 6110 17.4 236.5 24.7% 0.0% 0.0% 0.0% 17.16sec 974125 298.89sec
cyclotronic cyclotronic undulating_tides 303389 548425 1835 10.70 8172 16828 53.5 53.3 24.5% 0.0% 0.0% 0.0% 5.39sec 548425 298.89sec
cyclotronic cyclotronic_guardian_of_azeroth azerite_spike 295856 679146 11319 60.96 8956 17915 61.0 61.0 24.4% 0.0% 0.0% 0.0% 3.48sec 679146 60.00sec
cyclotronic cyclotronic_guardian_of_azeroth azerite_volley 303351 83494 1392 6.00 11229 22454 6.0 6.0 23.9% 0.0% 0.0% 0.0% 39.27sec 83494 60.00sec
fuse fuse augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
fuse fuse azerite_spike 295835 312712 1046 3.68 13808 28470 18.4 18.3 22.1% 0.0% 0.0% 0.0% 15.96sec 312712 298.89sec
fuse fuse berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.53sec 0 298.89sec
fuse fuse celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.39sec 0 298.89sec
fuse fuse conch_strike 304698 114578 383 2.73 6842 14098 13.7 13.6 21.9% 0.0% 0.0% 0.0% 21.12sec 163682 298.89sec
fuse fuse flask 298837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
fuse fuse food 297039 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
fuse fuse frost_blast 304645 175027 586 2.71 10508 21634 13.5 13.5 22.0% 0.0% 0.0% 0.0% 21.07sec 175027 298.89sec
fuse fuse guardian_of_azeroth 295840 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.47sec 0 298.89sec
fuse fuse gutripper 269031 161071 539 7.88 3308 6816 39.3 39.3 22.7% 0.0% 0.0% 0.0% 7.55sec 230101 298.89sec
fuse fuse heed_my_call 271685 106797 357 1.81 9587 19715 9.0 9.0 22.6% 0.0% 0.0% 0.0% 30.30sec 106797 298.89sec
fuse fuse heed_my_call_aoe 271686 45679 153 1.81 4108 8456 9.0 9.0 22.3% 0.0% 0.0% 0.0% 30.30sec 45679 298.89sec
fuse fuse lunar_strike 194153 1905369 6375 16.79 18471 38081 83.6 83.6 22.0% 0.0% 0.0% 0.0% 3.48sec 1905369 298.89sec
fuse fuse moonfire 8921 53744 180 2.85 3072 6318 14.2 14.2 22.2% 0.0% 0.0% 0.0% 21.23sec 922059 298.89sec
fuse fuse moonfire ticks -8921 868315 2894 48.85 2878 5931 14.2 244.2 22.2% 0.0% 0.0% 0.0% 21.23sec 922059 298.89sec
fuse fuse moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
fuse fuse potion 300714 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
fuse fuse potion_of_unbridled_fury 300717 430662 1441 16.36 4272 8802 81.5 81.5 22.3% 0.0% 0.0% 0.0% 3.01sec 430662 298.89sec
fuse fuse shooting_stars 202497 339074 1134 9.85 5596 11523 49.1 49.1 22.2% 0.0% 0.0% 0.0% 5.96sec 339074 298.89sec
fuse fuse solar_wrath 190984 1206901 4038 20.96 9342 19245 103.9 104.4 22.4% 0.0% 0.0% 0.0% 2.83sec 1206901 298.89sec
fuse fuse solar_wrath_empowered 279729 533220 1784 16.15 6630 0 80.4 80.4 0.0% 0.0% 0.0% 0.0% 3.62sec 533220 298.89sec
fuse fuse starsurge 78674 4309909 14420 13.19 53151 109534 65.9 65.7 22.1% 0.0% 0.0% 0.0% 4.56sec 4309909 298.89sec
fuse fuse stellar_flare 202347 41836 140 2.56 2655 5462 12.8 12.8 22.1% 0.0% 0.0% 0.0% 23.56sec 600427 298.89sec
fuse fuse stellar_flare ticks -202347 558591 1862 48.43 1870 3854 12.8 242.2 22.0% 0.0% 0.0% 0.0% 23.56sec 600427 298.89sec
fuse fuse storm_of_the_eternal 303725 156011 522 1.20 21058 43453 6.0 6.0 22.5% 0.0% 0.0% 0.0% 120.00sec 156011 298.89sec
fuse fuse storms_reckoning 300917 277668 929 10.99 4102 8455 55.1 54.7 22.3% 0.0% 0.0% 0.0% 5.34sec 277668 298.89sec
fuse fuse streaking_star 272873 2121413 7098 19.87 17359 35756 99.0 99.0 22.1% 0.0% 0.0% 0.0% 2.83sec 2121413 298.89sec
fuse fuse sunfire 93402 93583 313 3.56 4261 8787 17.8 17.8 22.3% 0.0% 0.0% 0.0% 16.87sec 1023672 298.89sec
fuse fuse sunfire ticks -93402 930089 3100 48.70 3092 6370 17.8 243.5 22.2% 0.0% 0.0% 0.0% 16.87sec 1023672 298.89sec
fuse fuse undulating_tides 303389 549093 1837 10.99 8127 16739 54.9 54.7 22.1% 0.0% 0.0% 0.0% 5.35sec 549093 298.89sec
fuse fuse_guardian_of_azeroth azerite_spike 295856 686873 11448 63.30 8899 17797 63.3 63.3 21.9% 0.0% 0.0% 0.0% 3.35sec 686873 60.00sec
fuse fuse_guardian_of_azeroth azerite_volley 303351 81211 1354 6.00 11162 22313 6.0 6.0 21.3% 0.0% 0.0% 0.0% 39.29sec 81211 60.00sec
leviathans leviathans augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
leviathans leviathans azerite_spike 295835 300606 1006 3.55 13803 28434 17.7 17.7 21.9% 0.0% 0.0% 0.0% 16.37sec 300606 298.89sec
leviathans leviathans berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.73sec 0 298.89sec
leviathans leviathans celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.58sec 0 298.89sec
leviathans leviathans conch_strike 304698 110619 370 2.62 6838 14091 13.2 13.1 22.6% 0.0% 0.0% 0.0% 21.12sec 158027 298.89sec
leviathans leviathans flask 298837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
leviathans leviathans food 297039 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
leviathans leviathans frost_blast 304645 171974 575 2.66 10497 21636 13.3 13.3 22.1% 0.0% 0.0% 0.0% 21.22sec 171974 298.89sec
leviathans leviathans guardian_of_azeroth 295840 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.47sec 0 298.89sec
leviathans leviathans gutripper 269031 155874 522 7.67 3308 6814 38.2 38.2 22.0% 0.0% 0.0% 0.0% 7.64sec 222677 298.89sec
leviathans leviathans heed_my_call 271685 103466 346 1.75 9577 19719 8.7 8.7 22.3% 0.0% 0.0% 0.0% 31.02sec 103466 298.89sec
leviathans leviathans heed_my_call_aoe 271686 44068 147 1.75 4105 8446 8.7 8.7 21.6% 0.0% 0.0% 0.0% 31.02sec 44068 298.89sec
leviathans leviathans leviathan_chomp 302763 597204 1998 2.62 37086 76396 13.1 13.0 22.2% 0.0% 0.0% 0.0% 21.50sec 853149 298.89sec
leviathans leviathans lunar_strike 194153 1873656 6269 16.50 18490 38100 82.2 82.2 22.0% 0.0% 0.0% 0.0% 3.54sec 1873656 298.89sec
leviathans leviathans moonfire 8921 53961 181 2.85 3076 6333 14.2 14.2 22.5% 0.0% 0.0% 0.0% 21.22sec 897356 298.89sec
leviathans leviathans moonfire ticks -8921 843395 2811 47.53 2874 5920 14.2 237.7 22.1% 0.0% 0.0% 0.0% 21.22sec 897356 298.89sec
leviathans leviathans moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
leviathans leviathans potion 300714 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
leviathans leviathans potion_of_unbridled_fury 300717 416657 1394 15.87 4273 8809 79.1 79.1 22.0% 0.0% 0.0% 0.0% 3.12sec 416657 298.89sec
leviathans leviathans shooting_stars 202497 327771 1097 9.51 5596 11511 47.4 47.4 22.3% 0.0% 0.0% 0.0% 6.15sec 327771 298.89sec
leviathans leviathans solar_wrath 190984 1178001 3941 20.52 9344 19238 101.7 102.2 22.0% 0.0% 0.0% 0.0% 2.88sec 1178001 298.89sec
leviathans leviathans solar_wrath_empowered 279729 521100 1743 15.83 6607 0 78.9 78.9 0.0% 0.0% 0.0% 0.0% 3.69sec 521100 298.89sec
leviathans leviathans starsurge 78674 4237963 14179 12.97 53069 109257 64.8 64.6 22.3% 0.0% 0.0% 0.0% 4.64sec 4237963 298.89sec
leviathans leviathans stellar_flare 202347 41660 139 2.56 2637 5429 12.8 12.8 22.5% 0.0% 0.0% 0.0% 23.56sec 585573 298.89sec
leviathans leviathans stellar_flare ticks -202347 543913 1813 47.12 1868 3847 12.8 235.6 22.3% 0.0% 0.0% 0.0% 23.56sec 585573 298.89sec
leviathans leviathans storm_of_the_eternal 303725 155798 521 1.20 21095 43461 6.0 6.0 22.2% 0.0% 0.0% 0.0% 120.00sec 155798 298.89sec
leviathans leviathans storms_reckoning 300917 269953 903 10.67 4100 8454 53.5 53.1 22.5% 0.0% 0.0% 0.0% 5.61sec 269953 298.89sec
leviathans leviathans streaking_star 272873 2100916 7029 19.67 17349 35747 98.0 98.0 22.2% 0.0% 0.0% 0.0% 2.86sec 2100916 298.89sec
leviathans leviathans sunfire 93402 92441 309 3.53 4250 8739 17.6 17.6 22.3% 0.0% 0.0% 0.0% 17.01sec 996146 298.89sec
leviathans leviathans sunfire ticks -93402 903706 3012 47.39 3088 6364 17.6 236.9 22.2% 0.0% 0.0% 0.0% 17.01sec 996146 298.89sec
leviathans leviathans undulating_tides 303389 535150 1790 10.71 8126 16728 53.5 53.3 22.2% 0.0% 0.0% 0.0% 5.60sec 535150 298.89sec
leviathans leviathans_guardian_of_azeroth azerite_spike 295856 669012 11150 61.48 8899 17797 61.5 61.5 22.3% 0.0% 0.0% 0.0% 3.45sec 669012 60.00sec
leviathans leviathans_guardian_of_azeroth azerite_volley 303351 81687 1361 6.00 11159 22318 6.0 6.0 22.0% 0.0% 0.0% 0.0% 39.29sec 81687 60.00sec
recalibration recalibration augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
recalibration recalibration azerite_spike 295835 322621 1079 3.69 13896 28604 18.4 18.4 25.0% 0.0% 0.0% 0.0% 15.88sec 322621 298.89sec
recalibration recalibration berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.48sec 0 298.89sec
recalibration recalibration celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.38sec 0 298.89sec
recalibration recalibration conch_strike 304698 117806 394 2.71 6886 14184 13.7 13.5 25.1% 0.0% 0.0% 0.0% 20.14sec 168295 298.89sec
recalibration recalibration flask 298837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
recalibration recalibration food 297039 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
recalibration recalibration frost_blast 304645 184877 619 2.78 10566 21769 13.8 13.8 24.9% 0.0% 0.0% 0.0% 20.40sec 184877 298.89sec
recalibration recalibration guardian_of_azeroth 295840 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.40sec 0 298.89sec
recalibration recalibration gutripper 269031 167209 559 7.97 3330 6856 39.7 39.7 24.9% 0.0% 0.0% 0.0% 7.26sec 238870 298.89sec
recalibration recalibration heed_my_call 271685 109469 366 1.82 9643 19847 9.1 9.1 23.7% 0.0% 0.0% 0.0% 30.39sec 109469 298.89sec
recalibration recalibration heed_my_call_aoe 271686 47183 158 1.82 4132 8510 9.1 9.1 24.3% 0.0% 0.0% 0.0% 30.39sec 47183 298.89sec
recalibration recalibration lunar_strike 194153 1891439 6328 16.96 17755 36587 84.5 84.5 24.6% 0.0% 0.0% 0.0% 3.44sec 1891439 298.89sec
recalibration recalibration moonfire 8921 52972 177 2.85 2951 6074 14.2 14.2 24.9% 0.0% 0.0% 0.0% 21.14sec 911924 298.89sec
recalibration recalibration moonfire ticks -8921 858952 2863 49.30 2765 5696 14.2 246.5 24.6% 0.0% 0.0% 0.0% 21.14sec 911924 298.89sec
recalibration recalibration moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
recalibration recalibration potion 300714 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
recalibration recalibration potion_of_unbridled_fury 300717 445321 1490 16.47 4303 8866 82.0 82.0 24.7% 0.0% 0.0% 0.0% 3.03sec 445321 298.89sec
recalibration recalibration shooting_stars 202497 334540 1119 9.90 5378 11075 49.3 49.3 24.6% 0.0% 0.0% 0.0% 6.04sec 334540 298.89sec
recalibration recalibration solar_wrath 190984 1201227 4019 21.31 8969 18493 105.7 106.2 24.6% 0.0% 0.0% 0.0% 2.78sec 1201227 298.89sec
recalibration recalibration solar_wrath_empowered 279729 527642 1765 16.32 6491 0 81.3 81.3 0.0% 0.0% 0.0% 0.0% 3.61sec 527642 298.89sec
recalibration recalibration starsurge 78674 4285938 14340 13.33 51275 105672 66.6 66.4 24.4% 0.0% 0.0% 0.0% 4.52sec 4285938 298.89sec
recalibration recalibration stellar_flare 202347 41192 138 2.56 2554 5255 12.8 12.8 24.8% 0.0% 0.0% 0.0% 23.55sec 594603 298.89sec
recalibration recalibration stellar_flare ticks -202347 553411 1845 48.87 1796 3701 12.8 244.4 24.6% 0.0% 0.0% 0.0% 23.55sec 594603 298.89sec
recalibration recalibration storm_of_the_eternal 303725 159526 534 1.20 21207 43725 6.0 6.0 24.3% 0.0% 0.0% 0.0% 120.00sec 159526 298.89sec
recalibration recalibration storms_reckoning 300917 287195 961 11.09 4127 8505 55.5 55.2 24.5% 0.0% 0.0% 0.0% 5.29sec 287195 298.89sec
recalibration recalibration streaking_star 272873 2237641 7487 20.40 17466 35992 101.6 101.6 24.6% 0.0% 0.0% 0.0% 2.78sec 2237641 298.89sec
recalibration recalibration sunfire 93402 92594 310 3.59 4103 8448 17.9 17.9 24.8% 0.0% 0.0% 0.0% 16.81sec 1013759 298.89sec
recalibration recalibration sunfire ticks -93402 921165 3071 49.14 2971 6121 17.9 245.7 24.7% 0.0% 0.0% 0.0% 16.81sec 1013759 298.89sec
recalibration recalibration undulating_tides 303389 569826 1907 11.08 8177 16848 55.4 55.2 24.7% 0.0% 0.0% 0.0% 5.28sec 569826 298.89sec
recalibration recalibration_guardian_of_azeroth azerite_spike 295856 705269 11754 63.17 8958 17912 63.2 63.2 24.6% 0.0% 0.0% 0.0% 3.36sec 705269 60.00sec
recalibration recalibration_guardian_of_azeroth azerite_volley 303351 83923 1399 6.00 11231 22469 6.0 6.0 24.5% 0.0% 0.0% 0.0% 39.28sec 83923 60.00sec
sandbag sandbag augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
sandbag sandbag azerite_spike 295835 304959 1020 3.59 13813 28425 17.9 17.9 22.1% 0.0% 0.0% 0.0% 15.96sec 304959 298.89sec
sandbag sandbag berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.63sec 0 298.89sec
sandbag sandbag celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.49sec 0 298.89sec
sandbag sandbag conch_strike 304698 111304 372 2.64 6839 14096 13.3 13.1 22.6% 0.0% 0.0% 0.0% 21.49sec 159006 298.89sec
sandbag sandbag flask 298837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
sandbag sandbag food 297039 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
sandbag sandbag frost_blast 304645 170232 570 2.64 10499 21669 13.1 13.1 22.0% 0.0% 0.0% 0.0% 22.22sec 170232 298.89sec
sandbag sandbag guardian_of_azeroth 295840 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.46sec 0 298.89sec
sandbag sandbag gutripper 269031 155265 519 7.66 3308 6813 38.2 38.2 21.7% 0.0% 0.0% 0.0% 7.64sec 221807 298.89sec
sandbag sandbag heed_my_call 271685 104781 351 1.78 9581 19740 8.8 8.8 22.3% 0.0% 0.0% 0.0% 30.21sec 104781 298.89sec
sandbag sandbag heed_my_call_aoe 271686 44789 150 1.78 4108 8444 8.8 8.8 22.0% 0.0% 0.0% 0.0% 30.21sec 44789 298.89sec
sandbag sandbag lunar_strike 194153 1792911 5999 16.52 17658 36391 82.3 82.3 22.0% 0.0% 0.0% 0.0% 3.54sec 1792911 298.89sec
sandbag sandbag moonfire 8921 51358 172 2.84 2936 6045 14.2 14.2 22.1% 0.0% 0.0% 0.0% 21.28sec 857023 298.89sec
sandbag sandbag moonfire ticks -8921 805665 2686 47.52 2744 5655 14.2 237.6 22.2% 0.0% 0.0% 0.0% 21.28sec 857023 298.89sec
sandbag sandbag moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
sandbag sandbag potion 300714 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
sandbag sandbag potion_of_unbridled_fury 300717 419507 1404 15.96 4273 8801 79.5 79.5 22.1% 0.0% 0.0% 0.0% 3.13sec 419507 298.89sec
sandbag sandbag shooting_stars 202497 310095 1038 9.45 5341 10982 47.1 47.1 22.0% 0.0% 0.0% 0.0% 6.30sec 310095 298.89sec
sandbag sandbag solar_wrath 190984 1125403 3765 20.50 8921 18388 101.7 102.1 22.2% 0.0% 0.0% 0.0% 2.88sec 1125403 298.89sec
sandbag sandbag solar_wrath_empowered 279729 499739 1672 15.88 6318 0 79.1 79.1 0.0% 0.0% 0.0% 0.0% 3.71sec 499739 298.89sec
sandbag sandbag starsurge 78674 4062562 13592 12.97 50828 104892 64.8 64.6 22.3% 0.0% 0.0% 0.0% 4.64sec 4062562 298.89sec
sandbag sandbag stellar_flare 202347 39716 133 2.56 2517 5188 12.8 12.8 22.3% 0.0% 0.0% 0.0% 23.56sec 558757 298.89sec
sandbag sandbag stellar_flare ticks -202347 519041 1730 47.11 1783 3674 12.8 235.6 22.2% 0.0% 0.0% 0.0% 23.56sec 558757 298.89sec
sandbag sandbag storm_of_the_eternal 303725 154866 518 1.20 21089 43464 6.0 6.0 21.5% 0.0% 0.0% 0.0% 120.00sec 154866 298.89sec
sandbag sandbag storms_reckoning 300917 269495 902 10.67 4102 8452 53.5 53.2 22.2% 0.0% 0.0% 0.0% 5.51sec 269495 298.89sec
sandbag sandbag streaking_star 272873 2102587 7035 19.64 17359 35750 97.9 97.9 22.5% 0.0% 0.0% 0.0% 2.87sec 2102587 298.89sec
sandbag sandbag sunfire 93402 88214 295 3.53 4053 8373 17.6 17.6 22.3% 0.0% 0.0% 0.0% 17.05sec 949997 298.89sec
sandbag sandbag sunfire ticks -93402 861783 2873 47.37 2949 6072 17.6 236.8 22.1% 0.0% 0.0% 0.0% 17.05sec 949997 298.89sec
sandbag sandbag undulating_tides 303389 534073 1787 10.66 8125 16750 53.3 53.1 22.4% 0.0% 0.0% 0.0% 5.53sec 534073 298.89sec
sandbag sandbag_guardian_of_azeroth azerite_spike 295856 667476 11125 61.45 8901 17805 61.4 61.4 22.0% 0.0% 0.0% 0.0% 3.45sec 667476 60.00sec
sandbag sandbag_guardian_of_azeroth azerite_volley 303351 81527 1359 6.00 11161 22330 6.0 6.0 21.7% 0.0% 0.0% 0.0% 39.29sec 81527 60.00sec
shiver shiver augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
shiver shiver azerite_spike 295835 302262 1011 3.55 13797 28454 17.7 17.7 22.6% 0.0% 0.0% 0.0% 15.96sec 302262 298.89sec
shiver shiver berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.79sec 0 298.89sec
shiver shiver celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.64sec 0 298.89sec
shiver shiver conch_strike 304698 111494 373 2.64 6840 14095 13.3 13.1 22.7% 0.0% 0.0% 0.0% 21.21sec 159277 298.89sec
shiver shiver flask 298837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
shiver shiver food 297039 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
shiver shiver frost_blast 304645 172982 579 2.67 10497 21627 13.3 13.3 22.4% 0.0% 0.0% 0.0% 21.32sec 172982 298.89sec
shiver shiver guardian_of_azeroth 295840 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.45sec 0 298.89sec
shiver shiver gutripper 269031 156488 524 7.68 3307 6817 38.3 38.3 22.3% 0.0% 0.0% 0.0% 7.59sec 223554 298.89sec
shiver shiver heed_my_call 271685 104082 348 1.76 9576 19738 8.8 8.8 22.3% 0.0% 0.0% 0.0% 31.90sec 104082 298.89sec
shiver shiver heed_my_call_aoe 271686 44766 150 1.76 4105 8455 8.8 8.8 22.8% 0.0% 0.0% 0.0% 31.90sec 44766 298.89sec
shiver shiver lunar_strike 194153 1874351 6271 16.48 18495 38090 82.1 82.1 22.1% 0.0% 0.0% 0.0% 3.54sec 1874351 298.89sec
shiver shiver moonfire 8921 53529 179 2.84 3070 6353 14.2 14.2 21.7% 0.0% 0.0% 0.0% 21.27sec 896113 298.89sec
shiver shiver moonfire ticks -8921 842584 2809 47.53 2875 5918 14.2 237.6 22.0% 0.0% 0.0% 0.0% 21.27sec 896113 298.89sec
shiver shiver moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
shiver shiver potion 300714 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
shiver shiver potion_of_unbridled_fury 300717 417907 1398 15.89 4274 8801 79.1 79.1 22.2% 0.0% 0.0% 0.0% 3.17sec 417907 298.89sec
shiver shiver shiver_venom ticks -301624 376204 1254 22.40 2717 5603 56.0 112.0 22.3% 0.0% 0.0% 0.0% 5.25sec 376204 298.89sec
shiver shiver venomous_shivers 305290 174459 584 0.98 28811 59700 4.9 4.9 22.8% 0.0% 0.0% 0.0% 62.22sec 174459 298.89sec
shiver shiver shooting_stars 202497 328113 1098 9.55 5590 11520 47.6 47.6 22.0% 0.0% 0.0% 0.0% 6.16sec 328113 298.89sec
shiver shiver solar_wrath 190984 1179752 3947 20.53 9344 19233 101.8 102.3 22.2% 0.0% 0.0% 0.0% 2.88sec 1179752 298.89sec
shiver shiver solar_wrath_empowered 279729 522849 1749 15.86 6617 0 79.0 79.0 0.0% 0.0% 0.0% 0.0% 3.69sec 522849 298.89sec
shiver shiver starsurge 78674 4242881 14196 12.97 53070 109300 64.8 64.6 22.4% 0.0% 0.0% 0.0% 4.64sec 4242881 298.89sec
shiver shiver stellar_flare 202347 41637 139 2.56 2637 5425 12.8 12.8 22.5% 0.0% 0.0% 0.0% 23.55sec 584795 298.89sec
shiver shiver stellar_flare ticks -202347 543157 1811 47.12 1868 3846 12.8 235.6 22.1% 0.0% 0.0% 0.0% 23.55sec 584795 298.89sec
shiver shiver storm_of_the_eternal 303725 156550 524 1.20 21068 43507 6.0 6.0 22.8% 0.0% 0.0% 0.0% 120.00sec 156550 298.89sec
shiver shiver storms_reckoning 300917 270213 904 10.68 4101 8450 53.5 53.2 22.5% 0.0% 0.0% 0.0% 5.51sec 270213 298.89sec
shiver shiver streaking_star 272873 2102177 7033 19.68 17355 35759 98.0 98.0 22.2% 0.0% 0.0% 0.0% 2.87sec 2102177 298.89sec
shiver shiver sunfire 93402 92073 308 3.53 4247 8766 17.6 17.6 21.9% 0.0% 0.0% 0.0% 17.04sec 995354 298.89sec
shiver shiver sunfire ticks -93402 903280 3011 47.38 3089 6359 17.6 236.9 22.2% 0.0% 0.0% 0.0% 17.04sec 995354 298.89sec
shiver shiver undulating_tides 303389 532379 1781 10.69 8126 16735 53.5 53.3 21.7% 0.0% 0.0% 0.0% 5.48sec 532379 298.89sec
shiver shiver_guardian_of_azeroth azerite_spike 295856 667088 11118 61.47 8900 17803 61.5 61.5 21.9% 0.0% 0.0% 0.0% 3.45sec 667088 60.00sec
shiver shiver_guardian_of_azeroth azerite_volley 303351 81982 1366 6.00 11163 22299 6.0 6.0 22.5% 0.0% 0.0% 0.0% 39.29sec 81982 60.00sec
zaquls zaquls augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
zaquls zaquls azerite_spike 295835 311647 1043 3.66 13809 28433 18.3 18.2 22.5% 0.0% 0.0% 0.0% 15.87sec 311647 298.89sec
zaquls zaquls berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.82sec 0 298.89sec
zaquls zaquls celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.68sec 0 298.89sec
zaquls zaquls conch_strike 304698 114615 383 2.71 6843 14092 13.6 13.5 22.6% 0.0% 0.0% 0.0% 20.93sec 163736 298.89sec
zaquls zaquls flask 298837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
zaquls zaquls food 297039 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
zaquls zaquls frost_blast 304645 176154 589 2.72 10505 21646 13.6 13.6 22.3% 0.0% 0.0% 0.0% 20.83sec 176154 298.89sec
zaquls zaquls guardian_of_azeroth 295840 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.48sec 0 298.89sec
zaquls zaquls gutripper 269031 160727 538 7.90 3309 6815 39.3 39.3 22.2% 0.0% 0.0% 0.0% 7.38sec 229610 298.89sec
zaquls zaquls heed_my_call 271685 106016 355 1.80 9588 19731 8.9 8.9 22.3% 0.0% 0.0% 0.0% 30.03sec 106016 298.89sec
zaquls zaquls heed_my_call_aoe 271686 45210 151 1.80 4108 8460 8.9 8.9 21.7% 0.0% 0.0% 0.0% 30.03sec 45210 298.89sec
zaquls zaquls lunar_strike 194153 1929306 6455 16.82 18657 38352 83.8 83.8 22.2% 0.0% 0.0% 0.0% 3.48sec 1929306 298.89sec
zaquls zaquls moonfire 8921 54102 181 2.86 3092 6385 14.2 14.2 21.6% 0.0% 0.0% 0.0% 21.17sec 926263 298.89sec
zaquls zaquls moonfire ticks -8921 872161 2907 48.76 2899 5968 14.2 243.8 22.1% 0.0% 0.0% 0.0% 21.17sec 926263 298.89sec
zaquls zaquls moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
zaquls zaquls potion 300714 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.89sec
zaquls zaquls potion_of_unbridled_fury 300717 429690 1438 16.35 4277 8811 81.5 81.5 22.0% 0.0% 0.0% 0.0% 3.05sec 429690 298.89sec
zaquls zaquls shooting_stars 202497 337815 1130 9.76 5636 11605 48.6 48.6 22.0% 0.0% 0.0% 0.0% 5.93sec 337815 298.89sec
zaquls zaquls solar_wrath 190984 1226485 4104 21.19 9402 19379 105.1 105.5 22.2% 0.0% 0.0% 0.0% 2.79sec 1226485 298.89sec
zaquls zaquls solar_wrath_empowered 279729 538579 1802 16.21 6670 0 80.7 80.7 0.0% 0.0% 0.0% 0.0% 3.61sec 538579 298.89sec
zaquls zaquls starsurge 78674 4347918 14547 13.24 53511 110120 66.2 66.0 21.9% 0.0% 0.0% 0.0% 4.54sec 4347918 298.89sec
zaquls zaquls stellar_flare 202347 41991 140 2.56 2675 5489 12.8 12.8 21.8% 0.0% 0.0% 0.0% 23.55sec 604172 298.89sec
zaquls zaquls stellar_flare ticks -202347 562181 1874 48.35 1884 3882 12.8 241.7 22.1% 0.0% 0.0% 0.0% 23.55sec 604172 298.89sec
zaquls zaquls storm_of_the_eternal 303725 155062 519 1.20 21072 43414 6.0 6.0 21.8% 0.0% 0.0% 0.0% 120.00sec 155062 298.89sec
zaquls zaquls storms_reckoning 300917 274825 919 10.90 4103 8454 54.6 54.3 22.1% 0.0% 0.0% 0.0% 5.45sec 274825 298.89sec
zaquls zaquls streaking_star 272873 2165048 7244 20.27 17365 35780 101.0 101.0 22.1% 0.0% 0.0% 0.0% 2.78sec 2165048 298.89sec
zaquls zaquls sunfire 93402 94422 316 3.57 4297 8824 17.8 17.8 22.3% 0.0% 0.0% 0.0% 16.77sec 1028854 298.89sec
zaquls zaquls sunfire ticks -93402 934432 3115 48.62 3114 6417 17.8 243.1 22.1% 0.0% 0.0% 0.0% 16.77sec 1028854 298.89sec
zaquls zaquls undulating_tides 303389 547753 1833 10.95 8127 16738 54.8 54.6 22.2% 0.0% 0.0% 0.0% 5.35sec 547753 298.89sec
zaquls zaquls_guardian_of_azeroth azerite_spike 295856 683528 11392 62.93 8900 17807 62.9 62.9 22.0% 0.0% 0.0% 0.0% 3.37sec 683528 60.00sec
zaquls zaquls_guardian_of_azeroth azerite_volley 303351 81482 1358 6.00 11159 22337 6.0 6.0 21.7% 0.0% 0.0% 0.0% 39.30sec 81482 60.00sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
405523.4 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 13.34% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:13.36%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 8.70% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.70%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 8.63% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:8.63%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 8.44% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:8.44%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 12.73% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:12.73%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 12.98% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:12.98%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.72% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.72%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 6.08% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:6.08%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.38% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.38%

Trigger Attempt Success

  • trigger_pct:100.00%
Condensed Life-Force (condensed_life_force) 10.9 68.4 28.0sec 3.6sec 44.98% 0.00% 68.4(68.4) 10.6

Buff details

  • buff initial source:sandbag
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:44.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Condensed Life-Force (condensed_life_force) 10.9 68.3 28.1sec 3.6sec 44.82% 0.00% 68.3(68.3) 10.6

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:44.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Condensed Life-Force (condensed_life_force) 11.2 70.0 27.3sec 3.5sec 45.47% 0.00% 70.0(70.0) 10.9

Buff details

  • buff initial source:zaquls
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:45.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Condensed Life-Force (condensed_life_force) 11.1 70.6 27.5sec 3.5sec 45.47% 0.00% 70.6(70.6) 10.8

Buff details

  • buff initial source:fuse
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:45.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Condensed Life-Force (condensed_life_force) 11.1 70.4 27.6sec 3.5sec 45.59% 0.00% 70.4(70.4) 10.8

Buff details

  • buff initial source:recalibration
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:45.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Condensed Life-Force (condensed_life_force) 10.9 67.7 28.1sec 3.6sec 44.86% 0.00% 67.7(67.7) 10.6

Buff details

  • buff initial source:cyclotronic
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:44.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Condensed Life-Force (condensed_life_force) 10.9 68.3 28.1sec 3.6sec 44.85% 0.00% 68.3(68.3) 10.6

Buff details

  • buff initial source:shiver
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:44.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Condensed Life-Force (condensed_life_force) 10.9 67.9 27.9sec 3.6sec 44.91% 0.00% 67.9(67.9) 10.7

Buff details

  • buff initial source:azsharas
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:44.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Luminous Algae (_debuff) 11.3 6.5 26.1sec 16.2sec 41.36% 0.00% 6.5(6.5) 0.0

Buff details

  • buff initial source:leviathans
  • cooldown name:buff_luminous_algae_debuff
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:4.00
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • luminous_algae_debuff_1:41.36%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:302775
  • name:Luminous Algae
  • tooltip:You have a $w1% increased chance to summon the Leviathan against this enemy.
  • description:
  • max_stacks:999
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 405523.37
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 1192
Mean 298.89
Minimum 240.09
Maximum 359.91
Spread ( max - min ) 119.82
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 1192
Mean 431537.89
Minimum 406417.74
Maximum 459399.15
Spread ( max - min ) 52981.41
Range [ ( max - min ) / 2 * 100% ] 6.14%
Standard Deviation 11564.7454
5th Percentile 414741.07
95th Percentile 450795.09
( 95th Percentile - 5th Percentile ) 36054.01
Mean Distribution
Standard Deviation 334.9639
95.00% Confidence Intervall ( 430881.38 - 432194.41 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2759
0.1 Scale Factor Error with Delta=300 1141711
0.05 Scale Factor Error with Delta=300 4566841
0.01 Scale Factor Error with Delta=300 114171004
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 1192
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 154
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 111134717 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 2700 2700 2700
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

\n\n